DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and Siah1

DIOPT Version :10

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_543181.2 Gene:Siah1 / 140941 RGDID:620449 Length:282 Species:Rattus norvegicus


Alignment Length:53 Identity:24/53 - (45%)
Similarity:32/53 - (60%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193
            |.|||||...:.||.:|||:|||:|.:||.:...||.||......|.|..|::
  Rat    38 LFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_canonical 25..104 CDD:483948
RING-HC_SIAHs 143..179 CDD:438233 18/35 (51%)
Siah1NP_543181.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RING_Ubox 36..86 CDD:473075 22/47 (47%)
Sina 82..278 CDD:460824 3/9 (33%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 90..282 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.