DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6688 and PATJ

DIOPT Version :9

Sequence 1:	NP_651110.1	Gene:	CG6688 / 42716	FlyBaseID:	FBgn0039038	Length:	424	Species:	Drosophila melanogaster
Sequence 2:	XP_011538764.1	Gene:	PATJ / 10207	HGNCID:	28881	Length:	1937	Species:	Homo sapiens

Alignment Length:	102	Identity:	28/102 - (27%)
Similarity:	43/102 - (42%)	Gaps:	5/102 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 GFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDPYP----WVCEVAAGTPAALCG 67
            |:|..|.....|.:.:.....:|.......|..||.:......|:.    :|..|.|...||..|
Human  1832 GYHLGSPTAEHHPEDTETPPPKIITLEKGSEGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAADDG 1896

  Fly    68 -LKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTI 103
             ||.||.:|.|||..:.|:...:...::|.|:..||:
Human  1897 RLKRGDQILAVNGETLEGVTHEQAVAILKHQRGTVTL 1933

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6688	NP_651110.1	PDZ_signaling	24..104	CDD:238492	24/85 (28%)
PATJ	XP_011538764.1	L27_2	8..65	CDD:117611
		PDZ_signaling	135..218	CDD:238492
		PDZ_signaling	246..325	CDD:238492
		PDZ_signaling	366..450	CDD:238492
		PDZ_signaling	570..634	CDD:238492
		PDZ	683..772	CDD:214570
		PDZ_signaling	1066..1157	CDD:238492
		PDZ	1236..1321	CDD:214570
		PDZ	1459..1574	CDD:214570
		PDZ_signaling	1586..1666	CDD:238492
		PDZ_signaling	1729..1814	CDD:238492
		PDZ_signaling	1852..1936	CDD:238492	24/82 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3528
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900