DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6688 and slc9a3r2

DIOPT Version :9

Sequence 1:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001135534.1 Gene:slc9a3r2 / 100216077 XenbaseID:XB-GENE-481282 Length:348 Species:Xenopus tropicalis


Alignment Length:113 Identity:34/113 - (30%)
Similarity:54/113 - (47%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSNEDGQHGDGSS------------VRLLRIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAGTPA 63
            ||:||..|.:.|:            .|..|:.........|||.|...|..|..::..|..|:||
 Frog   133 TSHEDQLHNNHSTENGKQDMNGQVKERCPRLCYLKKGPSGYGFNLHSEKSRPGQFIRSVDPGSPA 197

  Fly    64 ALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECD 111
            |..||:|.|.::||||.::..::.||:...:||:.:...:|..:.|.|
 Frog   198 AKAGLRPQDRLVEVNGQNIENMKHSEVVANIKSKDNETKLLVIDQETD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 25/79 (32%)
slc9a3r2NP_001135534.1 PDZ_signaling 8..87 CDD:238492
PDZ_signaling 161..240 CDD:238492 25/78 (32%)
EBP50_C 244..348 CDD:370238 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14191
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.