DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34375 and AT1G66650

DIOPT Version :10

Sequence 1:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_849853.1 Gene:AT1G66650 / 842983 AraportID:AT1G66650 Length:329 Species:Arabidopsis thaliana


Alignment Length:95 Identity:31/95 - (32%)
Similarity:48/95 - (50%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVK-CPVCRVPLGPRGRCLLSDKLFT--LLAE 186
            |.:||||.|.:.:|.|.:||.|||:.|..|..:..| |..|::|:|. .||...:|:..  |::.
plant    81 SNVLECPNCFDPLKKPIFQCNNGHLACFLCCIKLKKRCSFCKLPIGD-VRCRAMEKVIKAGLVSC 144

  Fly   187 SFPCDGGKTNKVAAS--QGHGKLSSVNKCT 214
            |....|.|.:....:  |.|.|:.....|:
plant   145 SNAIYGCKQSTTYGNQLQSHEKVCVFAPCS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34375NP_001163693.1 PDZ_canonical 11..81 CDD:467153
RING-HC_SIAHs 128..165 CDD:438233 16/37 (43%)
AT1G66650NP_849853.1 RING-HC_SIAHs 84..122 CDD:438233 16/37 (43%)
Sina 128..>209 CDD:460824 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.