DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34375 and AT1G66610

DIOPT Version :10

Sequence 1:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_176834.1 Gene:AT1G66610 / 842979 AraportID:AT1G66610 Length:366 Species:Arabidopsis thaliana


Alignment Length:364 Identity:74/364 - (20%)
Similarity:125/364 - (34%) Gaps:132/364 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LLECPVCLEVIKPPGWQCCNGHVLCNNCRSR-SVKCPVCRVPLGPRGRCLLSDKLFTLLAESFPC 190
            ||:||:|...:..|.:||..||:.|::|.:. |.|||.|.:.:|.     ...::...:.|:|  
plant    53 LLDCPICCNALTIPIFQCDKGHIACSSCCTNVSNKCPYCSLAIGN-----YRSRIMERVVEAF-- 110

  Fly   191 DGGKTNKVAASQGHGKLSSVNKCTNEYHNQPKMALAKTSSGKSKCGKQISRQLETVLVDQSPREI 255
                               :.:|       |.:|      |::...:|  ::|....:|:     
plant   111 -------------------IVRC-------PIVA------GEASSSRQ--KRLRVPSIDE----- 136

  Fly   256 RRKSQQGQEQEQAVQEAVLPRCTLIKVQHQEAAVEHFSEEGHNNMLVKPKLKLSKKSWRITGPDQ 320
                   :..|...::.|:|..||.::...:..|   ..:.....:.:..|.|:|:        |
plant   137 -------ENGENGGRDVVVPSGTLSQLDLLDCPV---CSKALKISIFQQSLFLAKR--------Q 183

  Fly   321 DGLRCDEVATINNGVQVQEQQQQQERQQLGHEKSASSESEYQNYHCPTG--------KSCSSHSY 377
            :|  |.|..:..|              :|.|||..|    :...:||..        |...||. 
plant   184 NG--CTETFSYGN--------------ELVHEKKCS----FALCYCPAPNCNYAGVYKDLYSHY- 227

  Fly   378 QLGQPVAN--KLST---------VAM----QALAVVENSGGASLSAGSHKQAPAA---GVNQELP 424
                 .||  ||.|         |.|    ::|.:.:.|.|..:.....|:.|..   .||...|
plant   228 -----AANHKKLWTRFSCGYSMHVCMDFESKSLVLQQYSDGPLVVLQCFKEPPQGLFWTVNCIAP 287

  Fly   425 LEAGSIGRREWQLLRHLSGDHRLAVLQIYGTFGERLHVR 463
             .|..:|:..::|              .|.|.|..|..|
plant   288 -SAPGVGKFSYEL--------------SYSTAGNTLTFR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34375NP_001163693.1 PDZ_canonical 11..81 CDD:467153
RING-HC_SIAHs 128..165 CDD:438233 15/37 (41%)
AT1G66610NP_176834.1 RING-HC_SIAHs 54..92 CDD:438233 15/37 (41%)
Sina 185..>313 CDD:460824 37/168 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.