DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34375 and AT3G61790

DIOPT Version :10

Sequence 1:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_567118.1 Gene:AT3G61790 / 825352 AraportID:AT3G61790 Length:326 Species:Arabidopsis thaliana


Alignment Length:70 Identity:33/70 - (47%)
Similarity:42/70 - (60%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSR-SVKCPVCRVPLGPRGRCLLSDKLFTLLAES 187
            :.:|||||||...:.||..||.|||.||:.|::| ..:||.||..||.. |||..:|    :|||
plant    57 VHELLECPVCTNSMYPPIHQCHNGHTLCSTCKARVHNRCPTCRQELGDI-RCLALEK----VAES 116

  Fly   188 --FPC 190
              .||
plant   117 LELPC 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34375NP_001163693.1 PDZ_canonical 11..81 CDD:467153
RING-HC_SIAHs 128..165 CDD:438233 19/37 (51%)
AT3G61790NP_567118.1 RING-HC_SIAHs 61..99 CDD:438233 19/37 (51%)
Sina 105..304 CDD:460824 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.