DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34375 and siah1

DIOPT Version :10

Sequence 1:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_005159200.1 Gene:siah1 / 80955 ZFINID:ZDB-GENE-010319-31 Length:334 Species:Danio rerio


Alignment Length:95 Identity:37/95 - (38%)
Similarity:51/95 - (53%) Gaps:13/95 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLFTLLAES- 187
            ::.|.|||||.:.:.||..||.:||::|:|||.:...||.||.|||.. |.|..:|    :|.| 
Zfish    87 LASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSI-RNLAMEK----VANSV 146

  Fly   188 -FPCDGGKTNKVAASQGHGKLSSVNKCTNE 216
             |||      |.|:|.....|...:|..:|
Zfish   147 LFPC------KYASSGCEVTLPHTDKAEHE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34375NP_001163693.1 PDZ_canonical 11..81 CDD:467153
RING-HC_SIAHs 128..165 CDD:438233 17/36 (47%)
siah1XP_005159200.1 RING-HC_SIAH2 88..138 CDD:438410 24/50 (48%)
Sina 134..330 CDD:460824 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.