DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34375 and Siah1

DIOPT Version :10

Sequence 1:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_543181.2 Gene:Siah1 / 140941 RGDID:620449 Length:282 Species:Rattus norvegicus


Alignment Length:95 Identity:37/95 - (38%)
Similarity:50/95 - (52%) Gaps:13/95 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKLFTLLAES- 187
            ::.|.|||||.:.:.||..||.:||::|:|||.:...||.||.|||.. |.|..:|    :|.| 
  Rat    35 LASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSI-RNLAMEK----VANSV 94

  Fly   188 -FPCDGGKTNKVAASQGHGKLSSVNKCTNE 216
             |||      |.|:|.....|....|..:|
  Rat    95 LFPC------KYASSGCEITLPHTEKAEHE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34375NP_001163693.1 PDZ_canonical 11..81 CDD:467153
RING-HC_SIAHs 128..165 CDD:438233 17/36 (47%)
Siah1NP_543181.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RING_Ubox 36..86 CDD:473075 24/50 (48%)
Sina 82..278 CDD:460824 14/48 (29%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 90..282 11/35 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.