DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or98a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:391 Identity:76/391 - (19%)
Similarity:165/391 - (42%) Gaps:43/391 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TNRLSAIQTLLVIQRWIGLLKWENEGEDGVLTWLKRIYPF---VLHLPLTFTYIALMWYEAITSS 65
            ||.|::..:....:..:..:.|.......::.::.....|   .::||:.   |.:.:...|.:.
  Fly    12 TNLLTSPDSFRYFEYGMFCMGWHTPATHKIIYYITSCLIFAWCAVYLPIG---IIISFKTDINTF 73

  Fly    66 DFEEAGQVLYMSITELALVTKLL--NIWYRR-HEAASLIHELQHDPAFNLRNSEEIKFWQQNQR- 126
            ...|...|:.:....:.:..|:|  |::... ::|..|:.|:. .....|:  |.::..|...| 
  Fly    74 TPNELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLLSEMD-KRCTTLK--ERVEVHQGVVRC 135

  Fly   127 NFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPF-EWRTRERYFYAWGYNVVAMTLCCL 190
            |...:.|.:|:.:..::.  ::|.....  :||:..|.|| ::|.....|:....|..|:.|..:
  Fly   136 NKAYLIYQFIYTAYTIST--FLSAALSG--KLPWRIYNPFVDFRESRSSFWKAALNETALMLFAV 196

  Fly   191 SNILLDTL-----GCYFMFHIASLFRLLGMRLEAL-----KNAAEEKARPELRRIFQLHTKVRRL 245
            :..|:..:     |.....|:    :||.:|:|:|     |:.||.:  .:|.:..:.|    .|
  Fly   197 TQTLMSDIYPLLYGLILRVHL----KLLRLRVESLCTDSGKSDAENE--QDLIKCIKDH----NL 251

  Fly   246 TRECEVLVSPYVLSQVVFSAFI---ICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYY 307
            ..:....:.|.| ::.:|..|:   ||. ...::::.|.......:.||.::..::||.|..|:.
  Fly   252 IIDYAAAIRPAV-TRTIFVQFLLIGICL-GLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFV 314

  Fly   308 GNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAY 372
            .:.|......|.:::|.:||:..|...:..|..:::..::.:...||..|.|.....:|....|:
  Fly   315 CDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAF 379

  Fly   373 S 373
            |
  Fly   380 S 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 65/323 (20%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 65/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.