DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or92a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:414 Identity:85/414 - (20%)
Similarity:168/414 - (40%) Gaps:75/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KWENEGEDGVLTWLKRIYPFVLHLPLTF------------------TYIALMWYEAITSSDFEE- 69
            |.:.:.:|.|:|     :..:...|:||                  .|: |.:|..:...:|.. 
  Fly     5 KRKPKSDDEVIT-----FDELTRFPMTFYKTIGEDLYSDRDPNVIRRYL-LRFYLVLGFLNFNAY 63

  Fly    70 -AGQVLY-----MSITELALVT--------------KLLNIWYRRHEAASLIHELQHDPAFNL-- 112
             .|::.|     ||.|.|...|              |...:...|.....|:.:|:.....:|  
  Fly    64 VVGEIAYFIVHIMSTTTLLEATAVAPCIGFSFMADFKQFGLTVNRKRLVRLLDDLKEIFPLDLEA 128

  Fly   113 RNSEEIKFWQQNQRNFKRIF------YWYIWGSLFVAVMGYISVFF--QEDYELPFGYYV--PFE 167
            :....:.|::::......:|      |...: |.:.|:...|..:.  .|.:|..:|:::  |::
  Fly   129 QRKYNVSFYRKHMNRVMTLFTILCMTYTSSF-SFYPAIKSTIKYYLMGSEIFERNYGFHILFPYD 192

  Fly   168 WRT--RERYFYAWGY----NVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNA--A 224
            ..|  ...:|..||.    .|..::..|:..:|:.|:     ..:...|..:...|||.:..  .
  Fly   193 AETDLTVYWFSYWGLAHCAYVAGVSYVCVDLLLIATI-----TQLTMHFNFIANDLEAYEGGDHT 252

  Fly   225 EEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVT 289
            :|:....|..:...|.:...|:.|...:.|..:|...:.::.:|||:.:::.....:.....|: 
  Fly   253 DEENIKYLHNLVVYHARALDLSEEVNNIFSFLILWNFIAASLVICFAGFQITASNVEDIVLYFI- 316

  Fly   290 TVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAG 354
               |.:..:||:|:.||||:|:...::.:.:|.|..|||..|...:::|...:...::|..:|..
  Fly   317 ---FFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPP 378

  Fly   355 VFFEIGLPIFVKTINNAYSFFALL 378
            .|..|....|:|.|:.:|.|||||
  Fly   379 TFPPISFNTFMKVISMSYQFFALL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 69/346 (20%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 63/325 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.