DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or85f

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:394 Identity:80/394 - (20%)
Similarity:155/394 - (39%) Gaps:85/394 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VLTWLKRIYPFVLH-------------------LPLTFTYIALMWYEAITSSDFE-------EAG 71
            :|.|:.|......|                   :.|...|..|:.|  |.:||.:       .|.
  Fly    37 ILYWIYRFLCLASHGVCVGVMVFRMVEAKTIDNVSLIMRYATLVTY--IINSDTKFATVLQRSAI 99

  Fly    72 QVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYI 136
            |.|...:.||...|.|..|::|.::                      .:|   .::|..:...||
  Fly   100 QSLNSKLAELYPKTTLDRIYHRVND----------------------HYW---TKSFVYLVIIYI 139

  Fly   137 WGSLFV-------AVMGYI--SVF-FQEDYELPFGYYVPFE---WRTRERYFYAWGYNVVAMTLC 188
            ..|:.|       :::.|.  :|| :...|  |:..|.|.:   |.....|...|.::    |..
  Fly   140 GSSIMVVIGPIITSIIAYFTHNVFTYMHCY--PYFLYDPEKDPVWIYISIYALEWLHS----TQM 198

  Fly   189 CLSNILLDTLGCYFM----FHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHTKVRRLTREC 249
            .:|||..|....||.    .|...:.|.|.....::|:..|:  |..:.:|......:..|..:.
  Fly   199 VISNIGADIWLLYFQVQINLHFRGIIRSLADHKPSVKHDQED--RKFIAKIVDKQVHLVSLQNDL 261

  Fly   250 EVLVSPYVLSQVVFSAFIIC-FSAYRLVHMGFKQRPGL-FVTTVQFVAVMIVQIFLPCYYGNELT 312
            ..:....:|..::.:|.:|| .:.|.|:     |.|.| ..|.|.|:...::|::|.||||.::.
  Fly   262 NGIFGKSLLLSLLTTAAVICTVAVYTLI-----QGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVL 321

  Fly   313 FHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFAL 377
            ..:..:.::|:..::.:.|:..::.|...:...::||::.|..:..|.|..|.:.::.:|....:
  Fly   322 DLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITM 386

  Fly   378 LLKI 381
            |:::
  Fly   387 LMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 68/331 (21%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 74/352 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.