DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or85d

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:406 Identity:87/406 - (21%)
Similarity:158/406 - (38%) Gaps:89/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QRWIG-LLKWENEGEDGVLTWLKRIYPF--VLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSI 78
            |:|.. ||.|         |::.::...  ||...|.:.::|:.     ..|:|.||  .:.:|.
  Fly    46 QKWKEVLLHW---------TFIAQMVNLNTVLISELIYVFLAIG-----KGSNFLEA--TMNLSF 94

  Fly    79 TELALV--TKLLNIWYRRHEAASLIHEL---------QHDPAFNLRN-----SEEIKF------- 120
            ....:|  .|:.||..:|.....::..|         |.:| :|:.:     |...||       
  Fly    95 IGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEP-YNIGHHLSGYSRYSKFYFGMHMV 158

  Fly   121 --WQQNQRNFKRIFYWYIWGSLFVAVMGYISVFF-----QEDYELPFGYYVPFEWRTRERYFYAW 178
              |..|       .||.::         |:...|     |.:..||:..:||::|.|...|::.:
  Fly   159 LIWTYN-------LYWAVY---------YLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMY 207

  Fly   179 GYNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLE-------ALKNAAEEKARPELRRIF 236
            ....:....|....:..|.|.|..:..:...|..|...:|       :.::..|     .|:...
  Fly   208 ISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHIESHVAGIGSFQHDLE-----FLQATV 267

  Fly   237 QLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGL----FVTTVQFVAVM 297
            ..|..:..|.::...:....:||..|.|:|||||       :||:...|.    .|..|.|:...
  Fly   268 AYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICF-------VGFQMTIGSKIDNLVMLVLFLFCA 325

  Fly   298 IVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLP 362
            :||:|:...:...|...:..:..:|:..:|....:..||:|...::..::|.:::|.:|..|.|.
  Fly   326 MVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLV 390

  Fly   363 IFVKTINNAYSFFALL 378
            .....:..:|.|||||
  Fly   391 TVSDLLQLSYKFFALL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 70/346 (20%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 70/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.