DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or85b

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:406 Identity:86/406 - (21%)
Similarity:161/406 - (39%) Gaps:83/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IGLLKWENEGEDGVLTWLKRIYPF-----VLHLPLTFTYIALMWYEAITSSDFEEAGQVL-YMSI 78
            :|:..:.| ||:..:.  |.|:..     |::|.....:.::..|.|...:.|.||...| |:..
  Fly    15 VGIRPYTN-GEESKMN--KLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGF 76

  Fly    79 TELALVTKLLNIWYRRHEAASLIHELQ--------HDPAFNL--------RNS------EEIKFW 121
            ..:.: :|:..|.:::.....||:||:        .:..:||        |.|      ..:..|
  Fly    77 VTVGM-SKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIW 140

  Fly   122 QQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYF-------YAWG 179
            ..|.  |..:.||.....|.:.|:|         .:||:..|:|::|:....|:       :| |
  Fly   141 TFNL--FCVMEYWVYDKWLNIRVVG---------KQLPYLMYIPWKWQDNWSYYPLLFSQNFA-G 193

  Fly   180 YNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAE--------EKARPELRRIF 236
            |...|      ..|..|.|.|       ::...|.|..:.|.|:.|        :|....|..|.
  Fly   194 YTSAA------GQISTDVLLC-------AVATQLVMHFDFLSNSMERHELSGDWKKDSRFLVDIV 245

  Fly   237 QLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQR----PGLFVTTVQFVAVM 297
            :.|.::.||:.....:....:|...:.|:|:|||       :||:..    |.:.|....|:...
  Fly   246 RYHERILRLSDAVNDIFGIPLLLNFMVSSFVICF-------VGFQMTVGVPPDIVVKLFLFLVSS 303

  Fly   298 IVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLP 362
            :.|::|.|:||..:...:...:.:.:...|.:..|..::.|...:...::...::|.:|.:|...
  Fly   304 MSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRS 368

  Fly   363 IFVKTINNAYSFFALL 378
            .....:..:|.|||||
  Fly   369 TMTDLLQISYKFFALL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 70/347 (20%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 70/346 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.