DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or85a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:391 Identity:71/391 - (18%)
Similarity:155/391 - (39%) Gaps:49/391 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLVIQRWIGLLKWENEGEDGVLTWLKRIYPFVLHLPLTFTYI-------ALMWYEAITSSDFEE 69
            :|:.:.|.|..:.|..........||..|:..|: :.|.|.:|       .:..::..|::|.  
  Fly    20 SLIYLNRSIDQMGWRLPPRTKPYWWLYYIWTLVV-IVLVFIFIPYGLIMTGIKEFKNFTTTDL-- 81

  Fly    70 AGQVLYMSI---TELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQR----- 126
               ..|:.:   |..:::..::.::.||          :...|..:.::.:|:..:..::     
  Fly    82 ---FTYVQVPVNTNASIMKGIIVLFMRR----------RFSRAQKMMDAMDIRCTKMEEKVQVHR 133

  Fly   127 -----NFKRIFYWYIW-GSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYFYAWGYNVVAM 185
                 |...:.|..|: |.|.:|:.|.:.:     .:.||..|.|.. ...:.::.|.....|.|
  Fly   134 AAALCNRVVVIYHCIYFGYLSMALTGALVI-----GKTPFCLYNPLV-NPDDHFYLATAIESVTM 192

  Fly   186 TLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAE---EKARPELRRIFQLHTKVRRLTR 247
            ....|:|::||.....::..:.....||..|::.|:...|   ::...||....:.|..:.....
  Fly   193 AGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAELVECVKDHKLIVEYGN 257

  Fly   248 ECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELT 312
            ....::|..:..|::....::..:|   |.|.|.......|.:..:...::.|.|..||...:|:
  Fly   258 TLRPMISATMFIQLLSVGLLLGLAA---VSMQFYNTVMERVVSGVYTIAILSQTFPFCYVCEQLS 319

  Fly   313 FHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFAL 377
            ....:|||::|.:.|:......|..:..::..:::.:...||..|.|.|...:|....|:|...:
  Fly   320 SDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTI 384

  Fly   378 L 378
            :
  Fly   385 V 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 57/322 (18%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 58/325 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.