DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or83c

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:253 Identity:51/253 - (20%)
Similarity:92/253 - (36%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 VPFEWRTRERYFYAWGYNVVAMTLCCLSNILLDTLGCY----FMF----HIASLFRLLGMRLEAL 220
            :|.|    ..|.|...|.:..:|:      |:..:|.|    |:|    .|.:...:|.::::.|
  Fly   170 LPLE----NNYCYVVTYMIQTVTM------LVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKEL 224

  Fly   221 KNAAEEKARPELRRIFQLHTKV------RRL-----------TRECEV-------LVSPYVLSQ- 260
            .:|.|:||  |.|.:.::...:      :||           |..|..       |::..|||. 
  Fly   225 NDALEQKA--EYRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYCRAINALYYELIATQVLSMA 287

  Fly   261 -VVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFG 324
             .:..:|.|..|::   ||          .:..|..|....:.:.|..|..|.|..:.:..|:..
  Fly   288 LAMMLSFCINLSSF---HM----------PSAIFFVVSAYSMSIYCILGTILEFAYDQVYESICN 339

  Fly   325 TNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLKIS 382
            ..|.|.|...|||....:...:.|..::.       |.:...::..|.....|:..:|
  Fly   340 VTWYELSGEQRKLFGFLLRESQYPHNIQI-------LGVMSLSVRTALQIVKLIYSVS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 48/241 (20%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 50/248 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.