DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Orco

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:475 Identity:72/475 - (15%)
Similarity:153/475 - (32%) Gaps:150/475 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GVLTWLKRIYPFV--LHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSITELAL---VTKL---- 87
            |...::|::|..|  :.|.:.||:|.:.     .:.:.||..::...:||.|..   :||.    
  Fly    36 GGSAFMKKVYSSVHLVFLLMQFTFILVN-----MALNAEEVNELSGNTITTLFFTHCITKFIYLA 95

  Fly    88 ---------LNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVA 143
                     ||||          :::...|.|   ...:.::........:::|:..:..::..|
  Fly    96 VNQKNFYRTLNIW----------NQVNTHPLF---AESDARYHSIALAKMRKLFFLVMLTTVASA 147

  Fly   144 VMGYISVFFQE------DYE-----------LPFGYYVPFEWRTRERYFY--AWGYNVVAMTLCC 189
            .......||.:      |:|           ||...:.|  |......||  ::.:.:..:....
  Fly   148 TAWTTITFFGDSVKMVVDHETNSSIPVEIPRLPIKSFYP--WNASHGMFYMISFAFQIYYVLFSM 210

  Fly   190 LSNILLDTLGCYFMF-------HI---------------------ASLFRLL------------- 213
            :.:.|.|.:.|.::.       |:                     |:|||.|             
  Fly   211 IHSNLCDVMFCSWLIFACEQLQHLKGIMKPLMELSASLDTYRPNSAALFRSLSANSKSELIHNEE 275

  Fly   214 --------------------------------------------GMRLEALKNAAEEKARPELRR 234
                                                        |.....|....|...|..::.
  Fly   276 KDPGTDMDMSGIYSSKADWGAQFRAPSTLQSFGGNGGGGNGLVNGANPNGLTKKQEMMVRSAIKY 340

  Fly   235 IFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFV---TTVQFVAV 296
            ..:.|..|.||...........:|..::.|...:...||:...:.     |:.|   |.|.::..
  Fly   341 WVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKIN-----GVNVYAFTVVGYLGY 400

  Fly   297 MIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGL 361
            .:.|:|..|.:||.|...::::..:.:..:|.:.|...:..:....:..::.:.:....||.:.|
  Fly   401 ALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSL 465

  Fly   362 PIFVKTINNAYSFFALLLKI 381
            .:|...:....::|.:|:::
  Fly   466 DLFASVLGAVVTYFMVLVQL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 62/428 (14%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 61/421 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.