DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or83a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:431 Identity:85/431 - (19%)
Similarity:161/431 - (37%) Gaps:105/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GVLTWLKR-------IYPFVLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSITELALVTKLLN 89
            |||..|.|       ::.:.:.:.:...||..: |......|.:.....|..:|  :.|.|..:.
  Fly    43 GVLAVLVRFCDLTYELFNYFVSVHIAGLYICTI-YINYGQGDLDFFVNCLIQTI--IYLWTIAMK 104

  Fly    90 IWYRRHEAASLIHELQH-DPAFNLRNSEEIKF------WQQNQRNFKRIFYWYIWGSLF--VAVM 145
            :::||.....|...|.: :..:..|::....|      ::.::...|...|....|::|  ...:
  Fly   105 LYFRRFRPGLLNTILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPI 169

  Fly   146 GYISVFFQEDYELPFGYYVPFEWRTRERY-----FYAWGYNVVA----------MTLCCLSNILL 195
            .|      .|..||...:.||::.....|     ..|.|...||          |.||.|.:...
  Fly   170 AY------RDRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQY 228

  Fly   196 DTLGCYFMFHIASLFRLLGM------RLEALKNAA------------EEKARPELRRI------- 235
            |.|.|.....:||.:.|:|.      :|:|.::||            ||....||.::       
  Fly   229 DVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFS 293

  Fly   236 ----------FQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAY------------RLVHM 278
                      .|.|..:....::.|...||....::....|::|..|:            |:|.:
  Fly   294 SAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMVSL 358

  Fly   279 GFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYME 343
            |            |::.:::.::|:.||:.:.:..::.....:::.:.|..:....|   :.||.
  Fly   359 G------------QYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVR---SDYMF 408

  Fly   344 FL---KRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLKI 381
            |:   :|..::.||....:.:..|..||..|:||..||.|:
  Fly   409 FMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQKM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 71/379 (19%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 59/305 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.