DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or67d

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:367 Identity:67/367 - (18%)
Similarity:134/367 - (36%) Gaps:61/367 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MWY-----EAITSSDFEEAGQVLYMSIT----------ELALV-------TKLL----NIWYRRH 95
            ||:     .|..:..|...|..:|:.:.          .||:|       ||||    |..:.| 
  Fly    38 MWWLTYAVMAAIAFFFACTGYTIYVGVVINGDLTIILQALAMVGSAVQGLTKLLVTANNASHMR- 101

  Fly    96 EAASLIHELQHDPAFNLRNSEEIKFWQQNQR-------NFKRIFYWYIWGSLFVAVMGYISVFFQ 153
            |..:...::..:  :..:..|..|..::..|       .| .:.|..:.|.:....:.|:.:..|
  Fly   102 EVQNTYEDIYRE--YGSKGDEYAKCLEKRIRITWTLLIGF-MLVYIILLGLVITFPIFYLLILHQ 163

  Fly   154 EDYELPFGYYVPF-EWRTRERYFYAWGYNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRL 217
            :  .|...:.:|| :..|...:......:|:.:|.....|...|.....|:.|:..:..:..::|
  Fly   164 K--VLVMQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFCVKL 226

  Fly   218 EALKNAAEEKAR-PELRRIF-------QLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYR 274
            ........::.. |::|.:.       ||:|::.:.|::...:|....||.....  ::|  ...
  Fly   227 TEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVG--LLC--TIS 287

  Fly   275 LVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTN--WLEYSVGTRKL 337
            .:.|  |..|    ....::....:.::..|..|. |..::|....||..||  |.|..|...||
  Fly   288 CIFM--KAWP----AAPLYLLYAAITLYTFCGLGT-LVENSNEDFLSVIYTNCLWYELPVKEEKL 345

  Fly   338 LNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLL 379
            :...:...:..|.:.|.....:.:...::.....|||..:|:
  Fly   346 IIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMMLM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 60/344 (17%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 57/327 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.