DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or59b

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:406 Identity:84/406 - (20%)
Similarity:168/406 - (41%) Gaps:53/406 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TNRLSAIQTLLVIQRWIGLLKWENEGEDGVLTWLKRIY---PF---VLHLPLTFTYIALMWYEAI 62
            |.::.:.|..:.:.|.:.|:.| ...::|||.::...:   ||   |.:||:.|....:..::..
  Fly    13 TEKVQSRQGNIYLYRAMWLIGW-IPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYVQEFKNF 76

  Fly    63 TSSDFEEAGQV--------LYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIK 119
            |..:|..:.||        :..:||.|.|        :|..:...|:..|....|   .:|:..:
  Fly    77 TPGEFLTSLQVCINVYGASVKSTITYLFL--------WRLRKTEILLDSLDKRLA---NDSDRER 130

  Fly   120 FWQQNQR-NFKRIFYWYIW----GSLFVAVMGYISVFFQEDYEL----PFGYYVPF-EWRTRERY 174
            ......| |:..:.|.:|:    ||.|::            |.|    |:..|.|| :||.....
  Fly   131 IHNMVARCNYAFLIYSFIYCGYAGSTFLS------------YALSGRPPWSVYNPFIDWRDGMGS 183

  Fly   175 FYAWG-YNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQL 238
            .:... :..:.|:...|.:.|.||....|.....:...:|...:.:|:...|.......:.:...
  Fly   184 LWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNC 248

  Fly   239 HTKVRRLTRECEVLVSPYVLSQVVFSAFIICFS--AYRLVHMGFKQRPGLFVTTVQFVAVMIVQI 301
            ....:.:.:.|: ::.| ::|:.:|..|.:..|  ...||::.|.......|.::.||..:::|.
  Fly   249 VLDHKTILKCCD-MIRP-MISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQT 311

  Fly   302 FLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVK 366
            |..||..|.|...|..|:|.:|.:||::.....:..|..:|..:::|:...||..|.|.:...:.
  Fly   312 FPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNIT 376

  Fly   367 TINNAYSFFALLLKIS 382
            ....|:|...::.:::
  Fly   377 VAKFAFSIITIVRQMN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 67/326 (21%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 68/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.