DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or56a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:371 Identity:76/371 - (20%)
Similarity:147/371 - (39%) Gaps:77/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YEAITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNL---RNSEEIKF 120
            ||.:.......|..|.|.:::     ..:.|.:.:|.:..||: .:.|....||   .::.|::.
  Fly    69 YENLNDGATSYATAVQYFAVS-----IAMFNAYVQRDKVISLL-RVAHSDIQNLMHEADNREMEL 127

  Fly   121 WQQNQRNFKRIFYWYIW-GSLFVAVMGYISVFFQEDYELPFGYY-VPFEWRTRER-----YFYAW 178
            ....|. :.|.....|| .|:...:|.|....::..: ||...: ||...|..|.     ..:.:
  Fly   128 LVATQA-YTRTITLLIWIPSVIAGLMAYSDCIYRSLF-LPKSVFNVPAVRRGEEHPILLFQLFPF 190

  Fly   179 GYNVVAMTLCCLSNILLDTLGCYF----------MFH--IASLFRLLGMRLEALKNAAEEKARPE 231
            |      .||  .|.::..||.::          ::|  |..|.:.:.::|:.|....||.....
  Fly   191 G------ELC--DNFVVGYLGPWYALGLGITAIPLWHTFITCLMKYVNLKLQILNKRVEEMDITR 247

  Fly   232 LR------------------RIFQLHTK----VRRLTRECEVLVSPYVLSQVVFSAFIICFSAYR 274
            |.                  ::|:...|    :|:..:|.:.|:...|::..:..:.:|||..:.
  Fly   248 LNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFIIFSVLICFLFFA 312

  Fly   275 LVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHA-------NALTNSVFGTNWLEYSV 332
            |. :|...:...|   ..|:.:.::...|..|:     :||       :.|:.:.|...|..:.:
  Fly   313 LT-VGVPSKMDYF---FMFIYLFVMAGILWIYH-----WHATLIVECHDELSLAYFSCGWYNFEM 368

  Fly   333 GTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALL 378
            ..:|:|...|...:||:|:|| :..::.|..|:.....|||:|.||
  Fly   369 PLQKMLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 68/356 (19%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 57/300 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.