DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or47b

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:386 Identity:79/386 - (20%)
Similarity:156/386 - (40%) Gaps:56/386 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVIQRWIGLLKWENEGEDGVLTWLKRIYPFVLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSI 78
            |.:.|||.|                    |::...:|..:  .|:.....|.:..|.|..| :.|
  Fly    58 LPLYRWINL--------------------FIMCNVMTIFW--TMFVALPESKNVIEMGDDL-VWI 99

  Fly    79 TELALV-TKLLNIWYRRHEAASLIHELQHDPAFN--LRN---SEEIKFWQQNQRNFKRIFYWYIW 137
            :.:||| ||:..:..|..|...||.:.::   :|  ||.   .||:..||       |:.| .|.
  Fly   100 SGMALVFTKIFYMHLRCDEIDELISDFEY---YNRELRPHNIDEEVLGWQ-------RLCY-VIE 153

  Fly   138 GSLFV---AVMGYIS--VFFQE---DYELPFGYYVPFEWRTRERYFYAWGYNVVAMTLC----CL 190
            ..|::   .::.:.|  :|.|.   :.:|||....||:|...:.:.|.:.:..:..:|.    .:
  Fly   154 SGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLM 218

  Fly   191 SNILLDTLGCYFMFHIASLFRLLGMRLEAL--KNAAEEKARPELRRIFQLHTKVRRLTRECEVLV 253
            |.:::|.:|.......|...:||.:.:..|  ...::::...|..|:.:.|..:.:|..:.....
  Fly   219 SILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAF 283

  Fly   254 SPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANAL 318
            :....:|::.|..:|..|.:..:...... |.:....|..:.|..:|:.|.|..|..:...:..:
  Fly   284 NGAFNAQLMASFSLISISTFETMAAAAVD-PKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEV 347

  Fly   319 TNSVFGTN-WLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALL 378
            ..:.|..| |...|.|.::.::..:...::|:...|..|....|..::..:.|.|...||:
  Fly   348 AQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 67/326 (21%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 67/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.