DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or42b

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:393 Identity:78/393 - (19%)
Similarity:162/393 - (41%) Gaps:61/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ENEGEDGVLTWLKRIYPFVLHLP----------LTFTYIALMW----------------YEAITS 64
            :....||.: :|.|...|:..||          ||:|.:..:|                .::.:.
  Fly    14 QKRSRDGCI-YLYRAMKFIGWLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSP 77

  Fly    65 SDFEEAGQV---LYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLR-----NSEEIKFW 121
            .:|..:.||   .|.|..::|:...:|   :|..:|.:::.:|      :||     ..|:|...
  Fly    78 GEFLTSLQVCINAYGSSVKVAITYSML---WRLIKAKNILDQL------DLRCTAMEEREKIHLV 133

  Fly   122 QQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPF-EWRTRE-RYFYAWGYNVVA 184
            .....:...||.:...|   .|...|:|.....  ..|:..|.|| :|.... :.:.|.....:.
  Fly   134 VARSNHAFLIFTFVYCG---YAGSTYLSSVLSG--RPPWQLYNPFIDWHDGTLKLWVASTLEYMV 193

  Fly   185 MTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALK---NAAEEKARPELRRIFQLHTKVRRLT 246
            |:...|.:.|.|:....:...:.:...:|..|:..|:   |.:|.::..||.:....|   :.:.
  Fly   194 MSGAVLQDQLSDSYPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDH---KLIL 255

  Fly   247 RECEVLVSPYVLSQVVFSAFII--CFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGN 309
            |.| .::.| |:...:|:.|::  ....:.|:::.|.......:.:..||..:::|.|..||..|
  Fly   256 RYC-AIIKP-VIQGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCN 318

  Fly   310 ELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSF 374
            .:.....:||:::|.:||::.|...:..|..:::.:::|:...||..|:|.:...:.....|:|.
  Fly   319 LIMEDCESLTHAIFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSV 383

  Fly   375 FAL 377
            ..:
  Fly   384 ITI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 65/320 (20%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 65/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.