DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or35a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:402 Identity:80/402 - (19%)
Similarity:150/402 - (37%) Gaps:106/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DGVLTWL------KRIYPFVLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSITELALVTKLLN 89
            |..|.:|      :.:..|:..:|   ||:.|:      .:.|.....:|:..     .:.|.|.
  Fly    60 DAELRYLRFEASNRNLDAFLTGMP---TYLILV------EAQFRSLHILLHFE-----KLQKFLE 110

  Fly    90 IWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYI------ 148
            |:|.         .:..||    |...|:         |:::....|...|..|:.|.:      
  Fly   111 IFYA---------NIYIDP----RKEPEM---------FRKVDGKMIINRLVSAMYGAVISLYLI 153

  Fly   149 -SVFFQEDYELPFGYYVPFEWRTRERYFY-------AWGYNVVAMTLCCLSNILLDTLGCYFMFH 205
             .||...:....|.|.:.|.:.:...|.:       .|...|:...:...:|:|     |..:.|
  Fly   154 APVFSIINQSKDFLYSMIFPFDSDPLYIFVPLLLTNVWVGIVIDTMMFGETNLL-----CELIVH 213

  Fly   206 IASLFRLLGMRLE-ALKNAAEEKARPEL-RRIFQLHTKVRR-------LTRECEVLVSPYVLSQV 261
            :...:.||...|: |::.....:.||.: :::..|.||..|       ..::.|...:..|....
  Fly   214 LNGSYMLLKRDLQLAIEKILVARDRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMF 278

  Fly   262 VFSAFIIC---FSAYR--------LVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHA 315
            .|:|.::|   |.||.        .:..|.|        ||:.::  :.||      |::|.|..
  Fly   279 AFAAGLLCALSFKAYTNPMANYIYAIWFGAK--------TVELLS--LGQI------GSDLAFTT 327

  Fly   316 NALTNSVFGTNW---LEYSVGTR------KLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNA 371
            ::|:...:.|:|   |:||....      ||:|..:|...:|..|....:|.:.|...:|.:..:
  Fly   328 DSLSTMYYLTHWEQILQYSTNPSENLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQAS 392

  Fly   372 YSFFALLLKISK 383
            :|:|..|..:.:
  Fly   393 FSYFTFLTSMQR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 69/348 (20%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 74/375 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.