DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or30a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:246 Identity:52/246 - (21%)
Similarity:109/246 - (44%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 MGYISV-FFQEDYELPFGYYVPFEWRTRERYFYAWGY--------NVVAMTLCCLSNILLDTLGC 200
            :|:::. .|..:..||:|.|:|    |.:.|.||..|        .::|...||:.....:.:..
  Fly   138 IGFVTYPIFGSERVLPYGMYLP----TIDEYKYASPYYEIFFVIQAIMAPMGCCMYIPYTNMVVT 198

  Fly   201 YFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSA 265
            :.:|.|. :.|:|..:|.:|:....|:.|.|:....:...|:.........|.:...|.:.:...
  Fly   199 FTLFAIL-MCRVLQHKLRSLEKLKNEQVRGEIIWCIKYQLKLSGFVDSMNALNTHLHLVEFLCFG 262

  Fly   266 FIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEY 330
            .::|...:.|:   ..|.....|..:.::.::.....:..|..|||.|.:..:..:.:.:||:::
  Fly   263 AMLCVLLFSLI---IAQTIAQTVIVIAYMVMIFANSVVLYYVANELYFQSFDIAIAAYESNWMDF 324

  Fly   331 SVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLKI 381
            .|.|:|.|...:...::|:.:..|..:.:.|.:....:|..||||.||.::
  Fly   325 DVDTQKTLKFLIMRSQKPLAILVGGTYPMNLKMLQSLLNAIYSFFTLLRRV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 46/235 (20%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 46/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.