DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or24a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:417 Identity:90/417 - (21%)
Similarity:146/417 - (35%) Gaps:125/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TWLKRIYPFVLHLPLTFTYIALMWY-------EAITSSDFEEAGQVLYMSITELALVTKLLNIWY 92
            |.|.:::.|.....||:...|..:|       ...|:.|      .|....:.:..:.|::.||:
  Fly    36 TVLVKLWSFFNFFILTYGCYAEAYYGIHYIPINIATALD------ALCPVASSILSLVKMVAIWW 94

  Fly    93 RRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRN-----FKRIFYWYIWGSLFVAV-MGY---- 147
            .:.|..|||              |.::|..:.|::     :|:.||.......|:.: .|:    
  Fly    95 YQDELRSLI--------------ERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTST 145

  Fly   148 -ISVFFQED------------YELPFGY---------------YVPFEWRTRERYFYAWGYNVV- 183
             .||....|            ||.||..               |:...|.         ||..| 
  Fly   146 SYSVRHLIDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILVHWH---------GYITVV 201

  Fly   184 ----------------AMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKAR--P 230
                            .:.|.||.:.:.|.|..              ..:|...:.||| ||  .
  Fly   202 CFVGADGFFLGFCLYFTVLLLCLQDDVCDLLEV--------------ENIEKSPSEAEE-ARIVR 251

  Fly   231 ELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYR-LVHMGFKQRPGLFVTTVQFV 294
            |:.::...|.:|..||.....::....|:..|.|:.||..|... |:..|.    |:.|..|...
  Fly   252 EMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGL----GIIVYVVYTC 312

  Fly   295 AVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEI 359
            ||. |:|||.|..|:.:....:.|..|.|.::|..:||..:|     |..|   :..||.....|
  Fly   313 AVG-VEIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQK-----MTLL---MVARAQRVLTI 368

  Fly   360 GLPIF---VKTINNAYSFFALLLKISK 383
            .:|.|   ::|:.:...|...|:.::|
  Fly   369 KIPFFSPSLETLTSILRFTGSLIALAK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 79/366 (22%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 81/376 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.