DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or82a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:146/391 - (37%) Gaps:57/391 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KWENEGEDGVLTWLKRIYPFVLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSITELALVTKLL 88
            |.:.:..|.....||.|...:..:...:..|:   |.|...:|.|:....|.:..|.:..|.|:.
  Fly    18 KDDMDSTDSTALSLKHISSLIFVISAQYPLIS---YVAYNRNDMEKVTACLSVVFTNMLTVIKIS 79

  Fly    89 NIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQ 153
            .....|.:...:||..:             |..:|:..:..|    |..|..:||....::.|..
  Fly    80 TFLANRKDFWEMIHRFR-------------KMHEQSASHIPR----YREGLDYVAEANKLASFLG 127

  Fly   154 EDY-------------------------------ELPFGYYVPFEWRTRERYFYAWGYNVVAMTL 187
            ..|                               |||.....||.......|...:.|.|:...:
  Fly   128 RAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPGYEVCFLYTVLVTVV 192

  Fly   188 CCLSNILLDTLGCYFMFHIASLFRLLGMRLEALK-NAAEEKARPELRRIFQLHTKVRRLTRECEV 251
            .......:|.|...|..::.:.|:.|..::|..: .::|...:..|:.|.:.|..:..|:|:...
  Fly   193 VVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEPDTQIRLKSIVEYHVLLLSLSRKLRS 257

  Fly   252 LVSPYVLSQVVFSAFIICFSAYRLV-HMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHA 315
            :.:|.|:.|.|.::..:....|:|| :|.......|:.:   |...:::|:|:.||.|..:...:
  Fly   258 IYTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYAS---FFGSIMLQLFIYCYGGEIIKAES 319

  Fly   316 NALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLK 380
            ..:..:|..:||...|..||..|:..:...::.|.:||| ||...|..||.....|.|...|:..
  Fly   320 LQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAG-FFVASLANFVGICRTALSLITLIKS 383

  Fly   381 I 381
            |
  Fly   384 I 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 69/338 (20%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 67/329 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.