DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or2a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:381 Identity:82/381 - (21%)
Similarity:158/381 - (41%) Gaps:32/381 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WENEG---EDGVLTWLKRIYPFVLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSITELALVTK 86
            ||..|   ..||.:.|..:|...::|.:|..:...:....:.:::.....:.|.::||::....|
  Fly    22 WELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLK 86

  Fly    87 LLNIWYRR---HEAASLIH------ELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFV 142
            ..|::..|   ||..||:.      .|..||.......:|:...|...|.|..||       :|.
  Fly    87 FANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASIF-------VFG 144

  Fly   143 AVMGYISVFFQEDYELPFGYYVPFEW-RTRERYFYAWGYNVVAMTLCCLSNILLDTLG----CYF 202
            ..:..:.|..:.|.||.:..:...:| .:...|.....|.:..:.:..:.|...|:..    |..
  Fly   145 TTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLL 209

  Fly   203 MFHIASL---FRLLGMRLEALK-----NAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLS 259
            ..|:.:|   .|.:|.|.|...     .|..|:...||....:...:|.||....:.::|...::
  Fly   210 TGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMA 274

  Fly   260 QVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFG 324
            |.|.||.:.|..|...:::.........:.::.|.:.:.:::|:.||:|:.:...:.||.::.:.
  Fly   275 QFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYD 339

  Fly   325 TNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLK 380
            .||:|.....::.|...:...:||..:.||.:..:.|..|.:.:...||.|.|||:
  Fly   340 CNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 67/327 (20%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 67/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27053
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.