DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94b and Or1a

DIOPT Version :9

Sequence 1:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:370 Identity:74/370 - (20%)
Similarity:138/370 - (37%) Gaps:56/370 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VLHLPLTFTYIALMW-YEAITSSDF--EEAGQVLYMS---ITELALVTKLLNI---WYRRHEAAS 99
            ||..||.:..:.|.. :|..|...|  :...|::..|   :..|.:|:.||.:   ..:.|:...
  Fly    34 VLRSPLLYCIMCLTTSFELCTVCAFMVQNRNQIVLCSEALMHGLQMVSSLLKMAIFLAKSHDLVD 98

  Fly   100 LIHELQHDPAFNLRNSEEIKFWQQNQRN--FKRIFYWYIWGS-----LFVAVMGYISVFFQEDYE 157
            ||.::|  ..|...:....::..||||.  ...|::....|:     |....:..:......::.
  Fly    99 LIQQIQ--SPFTEEDLVGTEWRSQNQRGQLMAAIYFMMCAGTSVSFLLMPVALTMLKYHSTGEFA 161

  Fly   158 LPFGYYVPFEWRTRERYFYAWG--YNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEAL 220
            ....:.|...:...:.:.||..  ..|..::..|.|...:|||..:....::..:|.||.:|:.:
  Fly   162 PVSSFRVLLPYDVTQPHVYAMDCCLMVFVLSFFCCSTTGVDTLYGWCALGVSLQYRRLGQQLKRI 226

  Fly   221 KNAAEEKARPE--LRRIFQLHTKVRRLTRECEVLVSPYVLSQVVF-SAFIIC------FSAYRLV 276
            .:.. ..:|.:  |..||..|.::.::.:...     |...::.| ...|||      ...|.:.
  Fly   227 PSCF-NPSRSDFGLSGIFVEHARLLKIVQHFN-----YSFMEIAFVEVVIICGLYCSVICQYIMP 285

  Fly   277 H-------MGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGT-NWLEYSVG 333
            |       :||            |..|:..|:.:..:...::...|...:..::.. .|......
  Fly   286 HTNQNFAFLGF------------FSLVVTTQLCIYLFGAEQVRLEAERFSRLLYEVIPWQNLPPK 338

  Fly   334 TRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALL 378
            .|||....:|..:|.. |....|||:|.|:.|.....|.||..|:
  Fly   339 HRKLFLFPIERAQRET-VLGAYFFELGRPLLVWIFRTAGSFTTLM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 63/339 (19%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 59/317 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.