DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or94a and Or49a

DIOPT Version :9

Sequence 1:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:383 Identity:64/383 - (16%)
Similarity:138/383 - (36%) Gaps:48/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PWSLKSEEEWTFTGFVKRNYRFLLHLP-------ITFTFIGLMWLEAFISSNLEQAGQVLYMSIT 82
            ||       |.:  .:.|.|..|..:.       :|...|....|....|..:.|.....||..:
  Fly    31 PW-------WRY--LLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKIMRQGLHFFYMLSS 86

  Fly    83 EMALVVKILSIWHYRTEAWRLMYELQHAPDYQLHNQEEVDFWR-----REQRFFKWFFYIYILIS 142
            ::..:..:::    |....:|.:.|:....::..||.:.:..:     ..:.....::::.::::
  Fly    87 QLKFITFMIN----RKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVVMA 147

  Fly   143 LGVVYSGCTGVLFLEG-------YELPFAYYVPFEWQNERRYWFAYGYDMAGMTLTCISNITLDT 200
            |..:...|  :::|.|       |:..|...:.|:.:....|..||..|......  |.|::|.|
  Fly   148 LEPLVQSC--IMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQF--IVNVSLGT 208

  Fly   201 ------LGCYFLFHISLLYRLLGLRLRETKNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSP 259
                  :......|:..|..:|.......:..:.|..|   |.:|...||.:..|......:...
  Fly   209 DLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF---LASIIKRHQLMIRLQKDVNYVFGL 270

  Fly   260 YILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTN 324
            .:.|.:..::.::|...|   :..:.....:.||.:...:.:..|.|:...:|..:...:..|..
  Fly   271 LLASNLFTTSCLLCCMAY---YTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAK 332

  Fly   325 EVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382
            ..:.:.|.|.....:|.:...|...::|:.|.|.....:.|..|...:...|.|.|::
  Fly   333 AAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 51/324 (16%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 48/309 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.