DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nha2 and SLC9A5

DIOPT Version :9

Sequence 1:NP_001247251.1 Gene:Nha2 / 42710 FlyBaseID:FBgn0263390 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_004585.1 Gene:SLC9A5 / 6553 HGNCID:11078 Length:896 Species:Homo sapiens


Alignment Length:519 Identity:104/519 - (20%)
Similarity:187/519 - (36%) Gaps:143/519 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 TPGDEYKGP---KW-WLYIRSHWVNTSELVALLAIFLGLWAMGWVLLPEYSQPPTVIMRIAFLFV 284
            :||:...|.   :| |     |.|....||||           |:|:..       :.:|.| .:
Human    26 SPGEPPPGLELFRWQW-----HEVEAPYLVAL-----------WILVAS-------LAKIVF-HL 66

  Fly   285 GAQISGILVTFVHLPD-----MLGMLFFGVLYANLGLANFEGYQ----KFELFLREMALINIMLL 340
            ..:::.:      :|:     :||::..|::   |.:|....||    .|.|||    |..|:|.
Human    67 SRKVTSL------VPESCLLILLGLVLGGIV---LAVAKKAEYQLEPGTFFLFL----LPPIVLD 118

  Fly   341 AGLGLDGDAFKRLWFMILRLTL--LPTIVEVAAIAGLANLTLSMPWLWG---------------- 387
            :|           :||..||..  |..|:..|.:..|.|...:...|||                
Human   119 SG-----------YFMPSRLFFDNLGAILTYAVVGTLWNAFTTGAALWGLQQAGLVAPRVQAGLL 172

  Fly   388 --IALGLVITAVSPNVVVTVMLKLKEDRLGLNSGIHTLIYAMTTCNDVVAIFMFGVIISVIFSTT 450
              :..|.:|:||.|..|:.|.     :.:.:|..:..:::..:..||.|.:.::.|..|.:...:
Human   173 DFLLFGSLISAVDPVAVLAVF-----EEVHVNETLFIIVFGESLLNDAVTVVLYKVCNSFVEMGS 232

  Fly   451 SLTQ--QVLQGPI--------GIGIGLVFGYLYGSMLQYLPSRNATYANGLRFVLTILGGTIAVM 505
            :..|  ..|:|..        |..:||||.:|.....:: ..|.......|.|:|.......|.|
Human   233 ANVQATDYLKGVASLFVVSLGGAAVGLVFAFLLALTTRF-TKRVRIIEPLLVFLLAYAAYLTAEM 296

  Fly   506 G--SRVIGYTSAGALGCVTTAFIARIGWRREETRLTPQQLQAQQIASVPKRLDLMWKFLKPVSFA 568
            .  |.::..|..| |||               .:.....:..:...:|...:..:....:.|.|.
Human   297 ASLSAILAVTMCG-LGC---------------KKYVEANISHKSRTTVKYTMKTLASCAETVIFM 345

  Fly   569 LIGKEINFNVLQGHVIGYGALLVLVGSL-----FRLAFAYLSTYGGN------LSRKERAYITIS 622
            |:|    .:.:......:.:.||| |:|     ||.....|.|:..|      |.:.::..::..
Human   346 LLG----ISAVDSSKWAWDSGLVL-GTLIFILFFRALGVVLQTWVLNQFRLVPLDKIDQVVMSYG 405

  Fly   623 GFPKATVQAALGPVALDMARAASVASPEQLALAGNLLIISVLAIIFTAPLGAILMLRLAPYWLK 686
            |...|...|.:  :.||..:..          |.:..:.:.:.::|...:...|.::....|||
Human   406 GLRGAVAFALV--ILLDRTKVP----------AKDYFVATTIVVVFFTVIVQGLTIKPLVKWLK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nha2NP_001247251.1 Na_H_Exchanger 279..686 CDD:294713 89/458 (19%)
SLC9A5NP_004585.1 NhaP2 41..630 CDD:330436 100/504 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 701..720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 818..864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.