DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Kirrel3

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:578 Identity:112/578 - (19%)
Similarity:187/578 - (32%) Gaps:185/578 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 RFLSRGHTYR---------AVVGDTLVLPCQVENLGNFVLLWRR-------GTNVLTASNIMVTR 150
            |.::.|..|.         .|.|..:.|.|.:.....|| ||.:       |.::.:....:|..
Mouse    40 RRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFV-LWIKDGLALGVGRDLSSYPQYLVVG 103

  Fly   151 DERVRLIDGYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGP 215
            :   .|...::|:|...|.||...|.||......|.:...:.:||||....|.....:..|.|.|
Mouse   104 N---HLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDP 165

  Fly   216 ITLECKG-SGNPVPSIYWTKK----SGANKSTARIGDGP----ILTL----EKLERQQAGVYQCT 267
            :.|.|.. :..|..||.|.:|    :||..|...:.||.    :.||    ..:|..|:.|  |.
Mouse   166 LNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIV--CR 228

  Fly   268 ADN-----GVGDPVTVDMRLDVLYPP--DIQVEKS------------------------WIH--- 298
            |.|     |....||:|::    :||  ::.||..                        |..   
Mouse   229 ATNKAIPGGKETSVTIDIQ----HPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGH 289

  Fly   299 -----SGEGFEAKLVCIVFADPVA----------------------------------------- 317
                 |||.:...:....|::||:                                         
Mouse   290 IIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVF 354

  Fly   318 TVSWYQN-SFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGA 381
            :.:|..| |..|....|......:|...||::.::|||.|.|.|.|            :..|.||
Mouse   355 SCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRA------------VVPRVGA 407

  Fly   382 AEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILT--PEHRPASE 444
            .|            ..:|..::..|.:...:      ..:..:.:.|:...||.:  |..|.|..
Mouse   408 GE------------REVTLTVNGPPIISSTQ------TQHALHGEKGQIKCFIRSTPPPDRIAWS 454

  Fly   445 PLTHIMS------YTIKNLHPGGYYEAIVQAKNRYGWNEVSDI----FQFVVATNSQDIGPEDAE 499
            ...:::.      ||::.::.   .|.::....      :|:|    ||.:....:.:....|.|
Mouse   455 WKENVLESGTSGRYTVETVNT---EEGVISTLT------ISNIVRADFQTIYNCTAWNSFGSDTE 510

  Fly   500 VVASSKSRSNSAS--------------IGSLPGSTVLHTALLLALALSNCQFDRRRLG 543
            ::...:..|...|              ||...|:.|....|:..:....|...:|..|
Mouse   511 IIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCCARSQRSTG 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 7/30 (23%)
IG_like 109..195 CDD:214653 21/101 (21%)
Ig 118..191 CDD:143165 18/79 (23%)
IG_like 205..274 CDD:214653 24/86 (28%)
IGc2 213..273 CDD:197706 23/77 (30%)
IGc2 301..367 CDD:197706 19/107 (18%)
FN3 392..486 CDD:238020 15/105 (14%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 20/92 (22%)
Ig strand A' 56..60 CDD:409353 0/3 (0%)
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 3/4 (75%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 0/3 (0%)
Ig strand E 104..116 CDD:409353 3/14 (21%)
Ig strand G 132..143 CDD:409353 1/10 (10%)
IgI_2_KIRREL3-like 149..246 CDD:409416 27/98 (28%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 2/3 (67%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 2/6 (33%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 7/66 (11%)
Ig strand B 267..274 CDD:409353 0/6 (0%)
Ig strand C 279..286 CDD:409353 1/6 (17%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 1/5 (20%)
Ig strand G 321..334 CDD:409353 0/12 (0%)
Ig 335..416 CDD:416386 20/104 (19%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 16/111 (14%)
Ig strand B 436..440 CDD:409479 1/3 (33%)
Ig strand C 450..454 CDD:409479 2/3 (67%)
Ig strand E 481..485 CDD:409479 0/9 (0%)
Ig strand F 496..501 CDD:409479 0/4 (0%)
Ig strand G 509..512 CDD:409479 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.