DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Tmigd1

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:183 Identity:47/183 - (25%)
Similarity:76/183 - (41%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 LQARKGGPITLECKGSGNPV-PSIYWTKKSG------ANK--------STARIGDGPILTLEKLE 257
            |..:.|...:|||....:.. ..:.|.::.|      .||        |.....|..:....||:
Mouse    74 LDTQHGVQASLECAVQNHTEDEELLWYREDGIVDLKNGNKINISSVCVSPINESDNGVRFTCKLQ 138

  Fly   258 RQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGF-------EAKLVCIVFADP 315
            |.|.              |:|.:.|:|.:||        :.||.||       :..|||.|.::|
Mouse   139 RDQT--------------VSVTVVLNVTFPP--------LLSGNGFQTVEENSDVSLVCNVKSNP 181

  Fly   316 VATVSWYQN--SFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSL 366
            .|.:.||:|  :..::....:|..||.: ..|:|..:::.|.|.|||:|.:||
Mouse   182 QAQMMWYKNNSALVLEKGRHQIHQTRES-FQLSITKVKKSDNGTYSCIASSSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653
Ig strand B 118..122 CDD:409353
Ig strand C 131..135 CDD:409353
Ig strand E 160..164 CDD:409353
Ig strand F 174..179 CDD:409353
Ig strand G 188..191 CDD:409353
Ig_3 196..270 CDD:464046 15/76 (20%)
Ig_3 287..364 CDD:464046 26/85 (31%)
FN3 392..486 CDD:238020
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 22/72 (31%)
Ig strand B 171..175 CDD:409353 1/3 (33%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 1/3 (33%)
Ig strand F 224..229 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.