| Sequence 1: | NP_524454.2 | Gene: | klg / 42707 | FlyBaseID: | FBgn0017590 | Length: | 545 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038958934.1 | Gene: | Negr1 / 59318 | RGDID: | 708416 | Length: | 362 | Species: | Rattus norvegicus |
| Alignment Length: | 306 | Identity: | 91/306 - (29%) |
|---|---|---|---|
| Similarity: | 143/306 - (46%) | Gaps: | 22/306 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 SNVQQSAVAASTLTATLPRFLSRGHTYRAV------VGDTLVLPCQVENLGNFVLLWRRGTNVLT 142
Fly 143 ASNIMVTRDERVRLID----GYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPPSVRA 201
Fly 202 IPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQC 266
Fly 267 TADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQST 331
Fly 332 DRRIMATR-ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS 376 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| klg | NP_524454.2 | DUF1370 | 63..>124 | CDD:284518 | 17/45 (38%) |
| IG_like | 109..195 | CDD:214653 | 25/97 (26%) | ||
| Ig | 118..191 | CDD:143165 | 20/78 (26%) | ||
| IG_like | 205..274 | CDD:214653 | 23/68 (34%) | ||
| IGc2 | 213..273 | CDD:197706 | 21/59 (36%) | ||
| IGc2 | 301..367 | CDD:197706 | 19/66 (29%) | ||
| FN3 | 392..486 | CDD:238020 | |||
| Negr1 | XP_038958934.1 | FR1 | 38..55 | CDD:409353 | 7/16 (44%) |
| Ig strand A' | 40..46 | CDD:409353 | 0/5 (0%) | ||
| IG_like | 41..129 | CDD:214653 | 23/89 (26%) | ||
| Ig strand B | 48..56 | CDD:409353 | 5/7 (71%) | ||
| CDR1 | 56..60 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 61..68 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 10/34 (29%) | ||
| Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 122..129 | CDD:409353 | 3/7 (43%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 1/4 (25%) | ||
| IGc2 | 146..204 | CDD:197706 | 21/60 (35%) | ||
| Ig strand B | 150..157 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 1/1 (100%) | ||
| Ig strand E | 180..186 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 193..200 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 207..215 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 219..295 | CDD:404760 | 23/76 (30%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 3/5 (60%) | ||
| Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166337202 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.840 | |||||