DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and PTK7

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens


Alignment Length:355 Identity:80/355 - (22%)
Similarity:131/355 - (36%) Gaps:51/355 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQV 124
            |.:.:|.:...||  |.....|...|:         ..||:|.:|.:....:...|....|.|..
Human   390 AESDAGVYTCHAA--NLAGQRRQDVNI---------TVATVPSWLKKPQDSQLEEGKPGYLDCLT 443

  Fly   125 ENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQISDKIN----R 185
            :......::|.|       :.::::.|.|..:.....|.|:.:|..|...|.|..|....    :
Human   444 QATPKPTVVWYR-------NQMLISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSIEAQ 501

  Fly   186 DQVHTVEIL--VPPSVRAIPTSGQ-LQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGD 247
            .:|..:|.|  .||     |...| ::..|  ..|:.|..:|...|:|.|.:..|::.......:
Human   502 ARVQVLEKLKFTPP-----PQPQQCMEFDK--EATVPCSATGREKPTIKWERADGSSLPEWVTDN 559

  Fly   248 GPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVF 312
            ...|...::.|..||.|.|.|.||....:...::|.|......:||.......:|..|.|.|...
Human   560 AGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQ 624

  Fly   313 ADPVATVSWYQNSFPIQSTDRRIMATRANRHM-------LTIRHIQQEDFGNYSCVADNS--LGR 368
            .||...:.|       :..||.:..|:....|       |.|..:..||.|.|:|:|.||  :..
Human   625 GDPKPLIQW-------KGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKH 682

  Fly   369 SRKYMELSGRPGAAEFYSPKWGRSPDSYNL 398
            :...:.:..:|...|...|   .||..|.:
Human   683 TEAPLYVVDKPVPEESEGP---GSPPPYKM 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 17/91 (19%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 19/74 (26%)
Ig_3 287..364 CDD:464046 21/83 (25%)
FN3 392..486 CDD:238020 3/7 (43%)
PTK7NP_001257327.1 Ig_3 41..112 CDD:464046
Ig2_PTK7 136..230 CDD:409417
Ig strand B 154..158 CDD:409417
Ig strand C 167..171 CDD:409417
Ig strand E 191..195 CDD:409417
Ig strand F 205..210 CDD:409417
Ig strand G 217..220 CDD:409417
Ig_3 234..310 CDD:464046
Ig 337..409 CDD:472250 5/20 (25%)
Ig strand C 361..365 CDD:409389
Ig strand E 382..386 CDD:409389
Ig strand F 396..401 CDD:409389 0/4 (0%)
Ig 420..506 CDD:472250 17/92 (18%)
Ig strand B 437..441 CDD:409353 1/3 (33%)
Ig strand C 450..454 CDD:409353 0/3 (0%)
Ig strand E 472..476 CDD:409353 1/3 (33%)
Ig strand F 486..491 CDD:409353 2/4 (50%)
Ig strand G 499..502 CDD:409353 0/2 (0%)
Ig 528..592 CDD:409353 16/63 (25%)
Ig strand B 528..532 CDD:409353 1/3 (33%)
Ig strand C 541..545 CDD:409353 1/3 (33%)
Ig strand E 561..565 CDD:409353 1/3 (33%)
Ig strand F 575..580 CDD:409353 2/4 (50%)
Ig strand G 589..592 CDD:409353 0/2 (0%)
Ig_3 601..676 CDD:464046 21/81 (26%)
PTK_CCK4 798..1071 CDD:133178
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.