DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and iglon5

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:273 Identity:77/273 - (28%)
Similarity:128/273 - (46%) Gaps:16/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDG----YNLEISDLEPQDAGDY 175
            |:::||.|:::..... ..|...:|:|.......:.|.||.|.:.    :::.|..:...|.|.|
Zfish    41 GESVVLRCKIDEEVTH-KAWLNRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERVMVADEGPY 104

  Fly   176 VCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTK-KSGAN 239
            .|....: |:.:...|.::|....|.:..|......:|..:.|.|...|.|.|:|.|.. |.|. 
Zfish   105 TCSFQAR-NKPRTAHVYLIV
QVPARIVNISQDKSVNEGEDVNLFCLAVGRPEPTITWKDFKYGL- 167

  Fly   240 KSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFE 304
                 :.:|..|.:.:::|.||..::|..:|||..|.|..:::.|.|||.|...|: :.:..|..
Zfish   168 -----LNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTV
NYPPIITDVKN-MPAQVGKT 226

  Fly   305 AKLVCIVFADPVATVSWYQNS-FPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGR 368
            |.|.|...|.|.|:..||::. .|::|.:...:.....|.:|...::.::.||||:|.|.|.||.
Zfish   227 AILRCEAMAVPTASFEWYRDDRRPVESDNTLKIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGA 291

  Fly   369 SRKYMELSGRPGA 381
            |...| |..||||
Zfish   292 SNASM-LLFRPGA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 4/8 (50%)
IG_like 109..195 CDD:214653 18/83 (22%)
Ig 118..191 CDD:143165 16/76 (21%)
IG_like 205..274 CDD:214653 20/69 (29%)
IGc2 213..273 CDD:197706 18/60 (30%)
IGc2 301..367 CDD:197706 20/66 (30%)
FN3 392..486 CDD:238020
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 18/83 (22%)
Ig 35..123 CDD:299845 18/83 (22%)
Ig 125..>183 CDD:299845 15/63 (24%)
I-set 128..207 CDD:254352 23/84 (27%)
IG_like 217..298 CDD:214653 25/82 (30%)
ig 223..296 CDD:278476 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4772
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.