DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Cntn6

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_059079.2 Gene:Cntn6 / 53870 MGIID:1858223 Length:1028 Species:Mus musculus


Alignment Length:683 Identity:126/683 - (18%)
Similarity:211/683 - (30%) Gaps:258/683 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQ-QSAVAASTLTATLPRFLSRGHTY----- 110
            |..|...|.....|..|:        |:.|:..::. ...:|.:.:...|.|.......|     
Mouse    69 IDFGMTYHYRLDGGSLAI--------SSPRTDQDIGIYQCLATNPVGTILSRKAKLQFAYIEDFE 125

  Fly   111 ---RAVV----GDTLVLPC-QVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI--DGYNLEIS 165
               |:.|    |..:||.| ...:.|.....|     ....|.:.|..|:| |.:  |..||..:
Mouse   126 TKTRSTVSVREGQGVVLLCGPPPHFGELSYAW-----TFNDSPLYVQEDKR-RFVSQDTGNLYFA 184

  Fly   166 DLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSG---------------QLQARKGGP 215
            .:||.|.|:|.|.:::|    :.|. .:..||:...:.|.|               .:||.|...
Mouse   185 KVEPSDVGNYTCFVTNK----EAHR-SVQGPPTPLVLRTDGVMGEYEPKIEVRFPETIQAAKDSS 244

  Fly   216 ITLECKGSGNPVPSIYWTKKSGA--------NKSTARIGDGPILTLEKLERQQAGVYQCTADNGV 272
            |.|||...|||||.|.|.:..|:        :||.|      ||.:.|.:::..|.|:|.|.|..
Mouse   245 IKLECFALGNPVPDISWKRLDGSPMPGKIKYSKSQA------ILEIPKFQQEDEGFYECIAGNLR 303

  Fly   273 GDPVTVDMRLDVLYPPDIQVEK--------------------------SWIHSGE---------- 301
            |..:.....  :.|.|....:|                          :|:.:|:          
Mouse   304 GRNLAKGQL--IFYAPPEWEQKIQNTYLSIYDSLFWECKASGNPNPSYTWLKNGQRLNTEERIQI 366

  Fly   302 ---------------------------------------------------------GFEAKLVC 309
                                                                     |.:..:.|
Mouse   367 ENGTLIITMLNISDSGIYQCAAENKYQTIYANAELRVLASAPDFSKNPIKKISVVQVGGDISIEC 431

  Fly   310 IVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYME 374
            ...|.|.|::||.:.:..::.:.|.:.....:   |.|.::.:.|.|:|:|||.|..|..:....
Mouse   432 KPNAFPKASISWKRGTENLKQSKRVLFLEDGS---LKICNVTRADAGSYTCVATNQFGNGKSSGG 493

  Fly   375 LSGRPGAAEFYSPKWGRSPDSYNLTWKID-------------SYPPLEEV--------------- 411
            |..:........|.            |:|             |:.|..||               
Mouse   494 LVVKERTIITVPPS------------KMDVTVGESIVLPCQVSHDPTMEVLFVWYFNGDIIDLKK 546

  Fly   412 --------------RLLYRRVQMNE----------TYQQPGRWHDFILT-PEHRPASEPLTHIMS 451
                          .|:.|.:|:..          |.::.....|.|:. |...|....:.||.|
Mouse   547 GVAHFERIGGESVGDLMIRNIQLGHSGKYLCTVQTTLERLSAVADIIVRGPPGPPEDVKVEHISS 611

  Fly   452 YTIK-NLHPGGYYEA-----IVQAKNRY--GWNEVSDI---------------------FQF-VV 486
            .|.: :..||....:     .:|.:..:  ||..|:.:                     ::| ||
Mouse   612 TTSQLSWRPGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGQTYNATVVGLSPWVEYEFRVV 676

  Fly   487 ATNSQDIG-PEDAEVVASSKSRSNSASIGSLPG 518
            |.|:..|| |.....:..:|:...:.:.|::.|
Mouse   677 AGNNIGIGEPSKPSELLRTKASVPNVAPGNING 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 25/100 (25%)
Ig strand B 118..122 CDD:409353 2/3 (67%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 29/96 (30%)
Ig_3 287..364 CDD:464046 20/169 (12%)
FN3 392..486 CDD:238020 25/176 (14%)
Cntn6NP_059079.2 Ig 26..120 CDD:472250 10/58 (17%)
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353 1/3 (33%)
Ig strand F 97..102 CDD:409353 0/4 (0%)
Ig strand G 111..114 CDD:409353 1/2 (50%)
Ig 129..214 CDD:472250 26/95 (27%)
Ig strand B 140..144 CDD:409353 2/3 (67%)
Ig strand C 154..158 CDD:409353 1/8 (13%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 27/95 (28%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 3/9 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 3/83 (4%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 0/3 (0%)
Ig strand F 383..388 CDD:143205 0/4 (0%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig5_Contactin 408..496 CDD:409358 19/90 (21%)
Ig strand A 408..413 CDD:409358 0/4 (0%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 0/6 (0%)
Ig strand C 440..444 CDD:409358 1/3 (33%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 1/7 (14%)
Ig strand F 475..483 CDD:409358 5/7 (71%)
Ig strand G 489..496 CDD:409358 1/6 (17%)
Ig 500..598 CDD:472250 13/109 (12%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 1/3 (33%)
Ig strand F 574..579 CDD:409353 0/4 (0%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
FN3 598..691 CDD:238020 19/92 (21%)
FN3 <620..>912 CDD:442628 17/90 (19%)
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.