Sequence 1: | NP_524454.2 | Gene: | klg / 42707 | FlyBaseID: | FBgn0017590 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 286 | Identity: | 81/286 - (28%) |
---|---|---|---|
Similarity: | 135/286 - (47%) | Gaps: | 31/286 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 ATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDG--- 159
Fly 160 -YNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGS 223
Fly 224 GNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPP 288
Fly 289 DIQVEKSWIHSG--EGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATR-----ANRHMLT 346
Fly 347 ---IRHIQQEDFGNYSCVADNSLGRS 369 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klg | NP_524454.2 | DUF1370 | 63..>124 | CDD:284518 | 8/25 (32%) |
IG_like | 109..195 | CDD:214653 | 24/89 (27%) | ||
Ig | 118..191 | CDD:143165 | 20/76 (26%) | ||
IG_like | 205..274 | CDD:214653 | 20/68 (29%) | ||
IGc2 | 213..273 | CDD:197706 | 18/59 (31%) | ||
IGc2 | 301..367 | CDD:197706 | 21/73 (29%) | ||
FN3 | 392..486 | CDD:238020 | |||
NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 24/91 (26%) |
Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 59..63 | CDD:409353 | 1/3 (33%) | ||
FR2 | 64..70 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/6 (33%) | ||
CDR2 | 71..83 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 11/33 (33%) | ||
Ig strand D | 87..94 | CDD:409353 | 3/6 (50%) | ||
Ig strand E | 97..103 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/4 (25%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 136..205 | CDD:404760 | 18/70 (26%) | ||
Ig strand A' | 142..147 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 153..160 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 166..171 | CDD:409353 | 1/4 (25%) | ||
Ig strand D | 177..180 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 184..190 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 197..204 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 211..219 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 222..299 | CDD:404760 | 25/86 (29%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 239..243 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 292..297 | CDD:409353 | 3/4 (75%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143468 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |