DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and CNTN3

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_065923.1 Gene:CNTN3 / 5067 HGNCID:2173 Length:1028 Species:Homo sapiens


Alignment Length:430 Identity:97/430 - (22%)
Similarity:148/430 - (34%) Gaps:127/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ITAHASANA----------NASGLRKSSQRRNRAPLQMNCPILIVI-----------------SL 54
            ||.|..|..          |.|.:..|.:.|    .::|...|:||                 ||
Human    46 ITLHCEARGNPSPHYRWQLNGSDIDMSMEHR----YKLNGGNLVVINPNRNWDTGTYQCFATNSL 106

  Fly    55 GWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLV 119
            |.::...|.    ...|.:.|..:..||..:|::                          |..:|
Human   107 GTIVSREAK----LQFAYLENFKTKMRSTVSVRE--------------------------GQGVV 141

  Fly   120 LPC-QVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI--DGYNLEISDLEPQDAGDYVCQISD 181
            |.| ...:.|.....|     :.......|..|.| |.:  :..:|.||.:||.|.|:|.|.:: 
Human   142 LLCGPPPHSGELSYAW-----IFNEYPSFVEEDSR-RFVSQETGHLYISKVEPSDVGNYTCVVT- 199

  Fly   182 KINRDQVHTVEILVPPSVRAIPTSG---------------QLQARKGGPITLECKGSGNPVPSIY 231
                ..|....:|..|:...:.:.|               .|.|.||..:.|||...|||:|.|.
Human   200 ----SMVTNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQIN 260

  Fly   232 WTKKSG---ANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVG------------DPVTVDMR 281
            |.:..|   ::|...|...| :|.:...:::.||.|:|.|:|..|            .|..|.:.
Human   261 WRRSDGLPFSSKIKLRKFSG-VLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLI 324

  Fly   282 LDVLYPPDIQVEKS--WIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHM 344
            .||    :|.||.|  |           .|.....|..:..|.:|...:...:|    |:.....
Human   325 KDV----EIAVEDSLYW-----------ECRASGKPKPSYRWLKNGAALVLEER----TQIENGA 370

  Fly   345 LTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEF 384
            |||.::...|.|.:.|:|:|..|......||.....|.:|
Human   371 LTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDF 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 20/88 (23%)
Ig strand B 118..122 CDD:409353 2/3 (67%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 25/91 (27%)
Ig_3 287..364 CDD:464046 18/78 (23%)
FN3 392..486 CDD:238020
CNTN3NP_065923.1 Ig 25..120 CDD:472250 16/81 (20%)
Ig strand B 46..50 CDD:409353 2/3 (67%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
Ig strand E 82..86 CDD:409353 1/3 (33%)
Ig strand F 97..102 CDD:409353 0/4 (0%)
Ig strand G 111..114 CDD:409353 0/2 (0%)
Ig 129..214 CDD:472250 25/121 (21%)
Ig strand B 140..144 CDD:409353 2/3 (67%)
Ig strand C 154..158 CDD:409353 1/8 (13%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 0/2 (0%)
Ig 227..315 CDD:472250 25/88 (28%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/4 (50%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 320..403 CDD:472250 25/101 (25%)
Ig strand B 335..339 CDD:143205 1/14 (7%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 1/3 (33%)
Ig strand F 383..388 CDD:143205 1/4 (25%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig 408..496 CDD:472250 1/3 (33%)
Ig strand B 427..431 CDD:409353
Ig strand C 440..444 CDD:409353
Ig strand E 462..466 CDD:409353
Ig strand F 476..481 CDD:409353
Ig strand G 489..492 CDD:409353
Ig 498..598 CDD:472250
Ig strand B 517..521 CDD:409439
Ig strand C 532..536 CDD:409439
Ig strand E 560..564 CDD:409439
Ig strand F 574..579 CDD:409439
FN3 579..>1006 CDD:442628
Ig strand G 587..590 CDD:409439
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..713
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.