DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and OPCML

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:346 Identity:85/346 - (24%)
Similarity:148/346 - (42%) Gaps:55/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQMNCPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNS---RSMSNVQQSAVAASTLTATLPRF 103
            |...|  |:|:||..|         |.|...:..|..::   ::|.||......::||..|:...
Human     9 LPWKC--LVVVSLRLL---------FLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDR 62

  Fly   104 LSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI----DGYNLEI 164
            ::|                         :.|...:.:|.|.|...:.|.||.::    ..|::.|
Human    63 VTR-------------------------VAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMI 102

  Fly   165 SDLEPQDAGDYVC--QISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPV 227
            .:::..|.|.|.|  |..:.....:||.: :.|||.:..|  |..:...:|..:||.|...|.|.
Human   103 QNVDVYDEGPYTCSVQTDNHPKTSRVHLI-VQVPPQIMNI--SSDITVNEGSSVTLLCLAIGRPE 164

  Fly   228 PSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQV 292
            |::.|...| ..:....:.:...|.:..::|.|:|.|:|:|.|.|..|....:::.|.|||.|..
Human   165 PTVTWRHLS-VKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISK 228

  Fly   293 EKSWIHSG--EGFEAKLVCIVFADPVATVSWYQNSFPIQS-TDRRIMATRANRHMLTIRHIQQED 354
            .|   ::|  .|.:..|.|...|.|:|...|::....:.: .|...:..:.....||..::.::|
Human   229 AK---NTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKD 290

  Fly   355 FGNYSCVADNSLGRSRKYMEL 375
            :|||:|||.|.||.:...:.|
Human   291 YGNYTCVATNKLGNTNASITL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 10/63 (16%)
IG_like 109..195 CDD:214653 16/91 (18%)
Ig 118..191 CDD:143165 16/78 (21%)
IG_like 205..274 CDD:214653 19/68 (28%)
IGc2 213..273 CDD:197706 17/59 (29%)
IGc2 301..367 CDD:197706 18/66 (27%)
FN3 392..486 CDD:238020
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 22/113 (19%)
Ig strand A' 44..49 CDD:409353 2/4 (50%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 2/30 (7%)
Ig strand C 64..70 CDD:409353 2/30 (7%)
CDR2 71..83 CDD:409353 3/11 (27%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/33 (27%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 2/9 (22%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 135..206 CDD:404760 20/73 (27%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 1/4 (25%)
Ig strand C' 171..174 CDD:409353 1/3 (33%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 25/91 (27%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.