DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and negr1

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:352 Identity:99/352 - (28%)
Similarity:151/352 - (42%) Gaps:53/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 MSNVQQSAVAASTLTAT-------LPRFLSRGHTY------RAVV---GDTLVLPCQVENLGNFV 131
            |..||.:.|:...|||.       ||..|..|.|.      .:||   |||.:|.|.:.: |...
Zfish     4 MIAVQDACVSGQWLTAIILSLCCFLPSCLPAGQTVDYTTSSESVVSRQGDTALLRCYLLD-GISK 67

  Fly   132 LLWRRGTNVLTASNIMVTRDERVRLIDG------YNLEISDLEPQDAGDYVCQISDKIN-RDQVH 189
            ..|...::::.|.|...:.|.||.::..      |:|:|..::..|.|.|.|.|..:.| ..::.
Zfish    68 GAWLNRSSIIYAGNDKWSGDPRVSIVSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSERNLHPKLI 132

  Fly   190 TVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLE 254
            .:.:.|||.:..|  |..:...:|..::|.|..||.|.|.|.|...|   .|..:...|..|.:.
Zfish   133 QLIVKVPPKIYDI--SSDITVNEGSNVSLICAASGKPEPKISWRHIS---PSARKYESGEYLNIT 192

  Fly   255 KLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHS-GEGFEAKLVCIVFADPVAT 318
            .:.|.|||.|:|.|:|.:..|.|..:|:.|.:||.|...||  |. ..|..|.|.|...|.|...
Zfish   193 GISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIHEMKS--HGVRPGQVALLRCEAAAVPSPV 255

  Fly   319 VSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS------- 376
            ..||:....|......::...::|.:||::::.|:.:|||:|||.|.||.:...:.|:       
Zfish   256 FEWYKGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYGNYTCVAVNRLGTANASVPLNPIIEPTT 320

  Fly   377 --------------GRPGAAEFYSPKW 389
                          |..|.||.....|
Zfish   321 TSAVSSPASNPAMYGSTGGAEVLLACW 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 24/101 (24%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 24/73 (33%)
Ig_3 287..364 CDD:464046 25/77 (32%)
FN3 392..486 CDD:238020
negr1XP_009300786.1 Ig 42..121 CDD:472250 21/79 (27%)
Ig strand B 55..59 CDD:409353 1/3 (33%)
Ig strand C 67..71 CDD:409353 0/3 (0%)
Ig strand E 102..106 CDD:409353 2/3 (67%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig 140..222 CDD:472250 27/86 (31%)
Ig strand B 157..161 CDD:409256 1/3 (33%)
Ig strand C 170..174 CDD:409256 1/3 (33%)
Ig strand E 187..191 CDD:409256 1/3 (33%)
Ig strand F 201..206 CDD:409256 2/4 (50%)
Ig strand G 215..218 CDD:409256 1/2 (50%)
Ig 236..312 CDD:472250 22/75 (29%)
Ig strand B 242..246 CDD:409353 2/3 (67%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 3/4 (75%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.