DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Ly6g6f

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001156664.1 Gene:Ly6g6f / 433099 MGIID:3616082 Length:300 Species:Mus musculus


Alignment Length:169 Identity:39/169 - (23%)
Similarity:68/169 - (40%) Gaps:44/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GDTLVLPC--QVENLGNFVLLWRR----GTNVLTASNIMVTR----------DERVRLIDGYNLE 163
            |:::.:||  ....||..:|.|.|    |::.:..:.:.|.:          |.|.:|...|:|.
Mouse    29 GESVEMPCPSPPSLLGGQLLTWFRSPVAGSSTILVAQVQVDKPVSDLRKPEPDSRYKLFGNYSLW 93

  Fly   164 ISDLEPQDAGDYVCQISDKINRDQ---VHTVEILV----------PPSVRAIPTSGQLQARKGGP 215
            :.....:|||.|.|.:.|:.::.|   |:.|.:|.          .||..|:..| .:.||:...
Mouse    94 LEGSRDEDAGRYWCTVMDQNHKYQNWRVYDVSVL
KGSQFSVKSPDGPSCAALLCS-VVPARRLDS 157

  Fly   216 IT-LECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTL 253
            :| ||.:.:.......:|             |:|..|.|
Mouse   158 VTWLEGRNTVRGHAQYFW-------------GEGAALLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 24/98 (24%)
Ig strand B 118..122 CDD:409353 0/3 (0%)
Ig strand C 131..135 CDD:409353 1/3 (33%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 14/59 (24%)
Ig_3 287..364 CDD:464046
FN3 392..486 CDD:238020
Ly6g6fNP_001156664.1 V-set 26..127 CDD:462230 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.