DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and dpr11

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:324 Identity:83/324 - (25%)
Similarity:125/324 - (38%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GALAPPITAHASANANASGLRKSSQRRNRAPLQMNCPILIVISLGWLLHAHAG-SGGFAVEAAIS 74
            |.|...|.:|...:|.|:|.|.|..                   |......|| |...|...|||
  Fly    34 GILCLTIASHTQTSAEAAGGRVSGP-------------------GAGTSEGAGTSSASAASTAIS 79

  Fly    75 NRGSNS-------RSMSNVQQSAVAASTLTAT-------LPRFLSRGHTYRAVVGDTLVLPCQVE 125
            :..|..       .|::.|......||.|:||       |..:.:...|.:  :|....|||:|:
  Fly    80 SDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQ--IGTHAYLPCRVK 142

  Fly   126 NLGNFVLLW--RRGTNVLTASNIMVTRDER---VRLIDGY-NLEISDLEPQDAGDYVCQIS--DK 182
            .|||..:.|  .|..::||....:...|:|   ::..|.| .|:|..::.:|||.|.||:|  .|
  Fly   143 QLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPK 207

  Fly   183 IN-RDQVHTV----EILVPPS--VRAIPTSGQLQARKGGPITLEC--KGSGNPVPSIYW------ 232
            :: |.|:..|    |||..|.  |:|           |..:.|.|  :|:..|...|.|      
  Fly   208 VSARVQLQVVVPRTEILGEPDRYVKA-----------GSNVVLRCIVRGALEPPTFIMWYHGAEQ 261

  Fly   233 ----------------TKKSGANKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDPVTVDM 280
                            .:.||..:||  ||.   |.:|..:::..|.|.|:..|.....||:::
  Fly   262 LAADSRRHRTQLDPNLPEASGEGQST--IGS---LIIESAKKRDTGNYTCSPSNSPSATVTLNI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 32/98 (33%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 1/5 (20%)
Ig strand E 160..164 CDD:409353 2/4 (50%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 21/99 (21%)
Ig_3 287..364 CDD:464046
FN3 392..486 CDD:238020
dpr11NP_788586.1 Ig 125..216 CDD:472250 29/92 (32%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 24/108 (22%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 2/6 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.