DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and dpr16

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:366 Identity:80/366 - (21%)
Similarity:122/366 - (33%) Gaps:94/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SGGFAVEAAISNRGS------NSRSMSNVQQSAVAASTL---------TATLPRFLSRGHTYRAV 113
            |.|.|..|.|...||      |.:|..:...|...|..|         ...|||.........|.
  Fly   145 SSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNAT 209

  Fly   114 V--GDTLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYV 176
            |  |....|||::.......|.|.|            .|||.:..:                |:.
  Fly   210 VQAGQHAYLPCKLNQHSGKPLSWVR------------LRDEHIIAV----------------DHT 246

  Fly   177 CQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGS---GNPVPSIYWTKKSGA 238
            ..|:|......:.:..:....|..|:.|:....|..|........|.   ||. .|:.||     
  Fly   247 TFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNS-SSLSWT----- 305

  Fly   239 NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGDP-VTVDMRLDVLYPPD--IQVEKSWIHSG 300
                        |.::.:..:.||.|:|..   ..:| ::..::|.|:.|..  |...:.::.:|
  Fly   306 ------------LQIKYVNLEDAGWYECQL---ATEPKMSAKVQLFVITPRTELIGDRQRFVKAG 355

  Fly   301 EGFEAKLVCIVFADPVAT--VSWYQNSFPIQS--------------TDRRIM-ATRANRH---ML 345
            ...|  |.|||.....|.  :.||:....:.:              .||.|. :|..||:   .|
  Fly   356 SRVE--LHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSL 418

  Fly   346 TIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYS 386
            .|..:::...|||:|..:||...|.:...|||...|:...|
  Fly   419 VIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKS 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 21/76 (28%)
IG_like 109..195 CDD:214653 15/87 (17%)
Ig 118..191 CDD:143165 12/72 (17%)
IG_like 205..274 CDD:214653 13/71 (18%)
IGc2 213..273 CDD:197706 12/62 (19%)
IGc2 301..367 CDD:197706 22/85 (26%)
FN3 392..486 CDD:238020
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 33/180 (18%)
Ig <298..338 CDD:299845 11/60 (18%)
IG_like 352..447 CDD:214653 24/96 (25%)
Ig 358..439 CDD:143165 21/82 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.