DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and CG17839

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_996085.2 Gene:CG17839 / 39616 FlyBaseID:FBgn0036454 Length:1656 Species:Drosophila melanogaster


Alignment Length:484 Identity:107/484 - (22%)
Similarity:159/484 - (32%) Gaps:189/484 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VLPCQV-ENLGNFVLLWRRGTNVLTASNIMVTRDERVRLI-----DGYNLE---------ISDLE 168
            :|.|.| :|..|..::|::|..:|||..:.||:|.|||::     .|.|||         |..|:
  Fly    40 LLTCVVSDNSSNNTVIWKKGDEILTAGTVRVTKDHRVRILHDENPKGKNLETGGEVWVLLIKTLK 104

  Fly   169 PQDAGDYVCQI-SDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGN------- 225
            |.|:|.|:|:: ||.:.| .:|            |.|..:|.:..|||        ||       
  Fly   105 PNDSGAYICELNSDPVLR-SIH------------ILTVKELHSSTGGP--------GNSTDTSTA 148

  Fly   226 --------PVP------SIYWTKK--------------SGANKSTARIG--------DGPI-LTL 253
                    |.|      ..:|...              ..||.||..:|        ||.. :..
  Fly   149 ESSDVFLLPPPLDAQDNRSFWRPSQVPPLVTHDFTECCERANVSTQCMGFCNVHNILDGTTGIDP 213

  Fly   254 EKLERQQAGVYQCTADNGVGDPVTVDMRLDVL--------YPPDIQVEKSWI----HSGEGFEA- 305
            |..||...|:.:|.||.....|..||.::..|        |.|.....|:.:    |:..|.:. 
  Fly   214 EACERDFPGIVRCMADGRNHVPCCVDKQIPDLCQDMCRGEYTPFTDKLKTRVSCVQHTLSGLQCI 278

  Fly   306 -KLVCIVFADPV-----------ATVSWYQNSFPIQSTDRRIMATRANRHMLTIRHIQQEDFGNY 358
             |.|.::.:.|.           .|:.|   :.|.:..| |:.....|   ||..|...||    
  Fly   279 LKGVQLIPSSPTFVTIENVSETSVTIGW---TAPDKLAD-RVSGYTIN---LTTLHSFDED---- 332

  Fly   359 SCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNET 423
                           ||||     |........||:|.:|                         
  Fly   333 ---------------ELSG-----EIVHRTASDSPESISL------------------------- 352

  Fly   424 YQQPGRWHDFILTPEHRPASEPLTHIMSYTIKNLHPGGYYEAIVQAKNRYGWNEVSDIFQFVVAT 488
            |..|                   |:....|:.||.|...|..||.|.|.:|.:..::..:|...|
  Fly   353 YSVP-------------------TNQTQLTLSNLSPLTMYAVIVTATNEFGSSLPTERLRFFTHT 398

  Fly   489 NSQDIGPEDAEVVASSKSRSNSASIGSLP 517
            :        |....|....::..::..||
  Fly   399 S--------ASAAESKAGTTDKQAMPQLP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 31/91 (34%)
Ig strand B 118..122 CDD:409353 1/2 (50%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 3/12 (25%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 24/117 (21%)
Ig_3 287..364 CDD:464046 18/93 (19%)
FN3 392..486 CDD:238020 18/93 (19%)
CG17839NP_996085.2 Ig 33..116 CDD:472250 27/75 (36%)
DB 185..278 CDD:460293 23/92 (25%)
FN3 286..396 CDD:238020 35/184 (19%)
DB 424..515 CDD:460293
FN3 524..613 CDD:238020
DB 631..>705 CDD:460293
FN3 773..>1036 CDD:442628
FN3 934..1024 CDD:238020
Ig 1029..1103 CDD:472250
Ig strand B 1049..1053 CDD:409562
Ig strand C 1062..1066 CDD:409562
Ig strand E 1080..1083 CDD:409562
Ig strand F 1093..1098 CDD:409562
IG_like 1126..1216 CDD:214653
Ig strand B 1134..1138 CDD:409390
Ig strand C 1148..1152 CDD:409390
Ig strand E 1182..1186 CDD:409390
Ig strand F 1196..1201 CDD:409390
Ig strand G 1209..1212 CDD:409390
DB 1229..1315 CDD:460293
FN3 1323..1457 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.