DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and dpr20

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:317 Identity:62/317 - (19%)
Similarity:112/317 - (35%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SIRTGALAPPITAHAS----ANANASGLRKSSQRRNRAP-LQMNCPILIVISLGWLLHAHAGSGG 66
            |....||.|...|..|    :::|||....:...|||:. |..|..:.:.       ..|..|.|
  Fly   178 SQNVNALVPATVATTSSGLPSSSNASLATPTEPARNRSTGLVRNSAVKVD-------SKHPLSKG 235

  Fly    67 FAVEAAISNRGSNSRSMSNVQ--------------QSAVAASTLTATLPRFLSRGHTYRAVVGDT 117
            ...:|.:.|...::.|.:|..              |....|:.||..              .|.:
  Fly   236 QKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQ--------------AGSS 286

  Fly   118 LVLPCQVENLGNFVLLWRR------------GTNVLTASNIMVTRDERVRL----IDGYNLEISD 166
            :.|.|::..|.:..:.|.|            ..::||......|.|:|.::    .:.:.|:|::
  Fly   287 IHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITN 351

  Fly   167 LEPQDAGDYVCQIS---DKINRDQVHTVEILVPPSVRAIPTSGQLQARK----GGPITLECKGSG 224
            ::..|...|.||||   .::.:..:|    :..|.|..:...|.....|    ...:.|.|....
  Fly   352 VKKDDEAIYECQISTHPPRVIQINLH----VNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRN 412

  Fly   225 NPVPS--IYW----------TKKSGANKSTARIGDG--PILTLEKLERQQAGVYQCT 267
            ..:.|  ::|          ..:.|.:..|..:.||  ..|::.|:.:..:|.|.|:
  Fly   413 VAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 20/104 (19%)
Ig strand B 118..122 CDD:409353 1/3 (33%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 1/3 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 1/2 (50%)
Ig_3 196..270 CDD:464046 17/90 (19%)
Ig_3 287..364 CDD:464046
FN3 392..486 CDD:238020
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 44/210 (21%)
IG_like 278..365 CDD:214653 19/100 (19%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 0/3 (0%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 13/68 (19%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.