DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and dpr20

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:317 Identity:62/317 - (19%)
Similarity:112/317 - (35%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SIRTGALAPPITAHAS----ANANASGLRKSSQRRNRAP-LQMNCPILIVISLGWLLHAHAGSGG 66
            |....||.|...|..|    :::|||....:...|||:. |..|..:.:.       ..|..|.|
  Fly   178 SQNVNALVPATVATTSSGLPSSSNASLATPTEPARNRSTGLVRNSAVKVD-------SKHPLSKG 235

  Fly    67 FAVEAAISNRGSNSRSMSNVQ--------------QSAVAASTLTATLPRFLSRGHTYRAVVGDT 117
            ...:|.:.|...::.|.:|..              |....|:.||..              .|.:
  Fly   236 QKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQ--------------AGSS 286

  Fly   118 LVLPCQVENLGNFVLLWRR------------GTNVLTASNIMVTRDERVRL----IDGYNLEISD 166
            :.|.|::..|.:..:.|.|            ..::||......|.|:|.::    .:.:.|:|::
  Fly   287 IHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITN 351

  Fly   167 LEPQDAGDYVCQIS---DKINRDQVHTVEILVPPSVRAIPTSGQLQARK----GGPITLECKGSG 224
            ::..|...|.||||   .::.:..:|    :..|.|..:...|.....|    ...:.|.|....
  Fly   352 VKKDDEAIYECQISTHPPRVIQINLH----VNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRN 412

  Fly   225 NPVPS--IYW----------TKKSGANKSTARIGDG--PILTLEKLERQQAGVYQCT 267
            ..:.|  ::|          ..:.|.:..|..:.||  ..|::.|:.:..:|.|.|:
  Fly   413 VAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 13/74 (18%)
IG_like 109..195 CDD:214653 20/104 (19%)
Ig 118..191 CDD:143165 19/91 (21%)
IG_like 205..274 CDD:214653 15/81 (19%)
IGc2 213..273 CDD:197706 13/69 (19%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
dpr20NP_612066.1 IG_like 278..365 CDD:214653 19/100 (19%)
Ig 279..378 CDD:299845 22/116 (19%)
Ig 400..471 CDD:299845 13/70 (19%)
IG_like 402..480 CDD:214653 13/68 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.