DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and babos

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:134 Identity:36/134 - (26%)
Similarity:61/134 - (45%) Gaps:22/134 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GSNSRSMSNVQQSA---VAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQV-ENL--GNFVLLWR 135
            |...:|..:.|..:   ||:..:..||        :...:.|:.:||.|.| .||  .:.|:||.
  Fly    43 GGEDQSAPSPQTKSPNPVASEKINKTL--------SVTGIRGEDVVLKCDVGSNLHSSDVVVLWY 99

  Fly   136 RGTNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDYVCQI--SDKINRDQV----HTVEIL 194
            .|.||::....:|  ....:|...|:|.|....||.||.|:|::  |..:...:|    |:::.:
  Fly   100 FGDNVISNGKNLV--QPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAI 162

  Fly   195 VPPS 198
            .|.|
  Fly   163 APES 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 11/49 (22%)
IG_like 109..195 CDD:214653 27/94 (29%)
Ig 118..191 CDD:143165 26/81 (32%)
IG_like 205..274 CDD:214653
IGc2 213..273 CDD:197706
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
babosNP_001286719.1 ig 70..154 CDD:278476 26/85 (31%)
IG_like 70..154 CDD:214653 26/85 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.