DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and dpr2

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:364 Identity:80/364 - (21%)
Similarity:133/364 - (36%) Gaps:107/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PILIV---ISLGWLLHAHAGSGGFAVEAAISN-----RGSNS-----RSMSNVQQSAVAASTLTA 98
            |||::   ||..|.:.....|.......|:.:     .|:::     .:.|::....|..:::..
  Fly    14 PILVIMISISRAWTMQQQHLSPAIQQHPAVKSLSHLVDGNDNLLPMVSAPSSIDNDYVYIASVNR 78

  Fly    99 TLPRF----------------------------LSRGHTYRAVVGDTLVLPCQVENLGNFVLLW- 134
            ..|:|                            :.|..|.|  .|.|..:.|:|:|||:..:.| 
  Fly    79 KFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTR--TGHTAAINCRVDNLGDKSVSWI 141

  Fly   135 -RRGTNVLTASNIMVTRDER---VRLIDG--YNLEISDLEPQDAGDYVCQISDKINRDQVHTVEI 193
             :|..::|||..:..|.|||   ||..|.  :.|.:...:|:|:|.|.||::.:........:.:
  Fly   142 RKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNV 206

  Fly   194 LV-PPSVRAI---PTSGQLQARKGGPITLEC-----KGSGNPVPSIYWTKKSGANKSTARIGDGP 249
            :| ||..:||   ||  .|..:.|..:||.|     ..|...:..|||.:             ||
  Fly   207 IVTPPDAKAIIAGPT--DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYR-------------GP 256

  Fly   250 -ILT----------------------LEKLERQ---------QAGVYQCTADNGVGDPVTVDMRL 282
             |||                      .|||:.:         ..|.|.|.........|.|::..
  Fly   257 YILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVIN 321

  Fly   283 DVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSW 321
            |. .|..:|..::...||....::||.::.....:.|.|
  Fly   322 DE-SPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRW 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 13/98 (13%)
IG_like 109..195 CDD:214653 28/92 (30%)
Ig 118..191 CDD:143165 24/79 (30%)
IG_like 205..274 CDD:214653 20/105 (19%)
IGc2 213..273 CDD:197706 19/96 (20%)
IGc2 301..367 CDD:197706 4/21 (19%)
FN3 392..486 CDD:238020
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 29/94 (31%)
Ig 116..192 CDD:299845 27/77 (35%)
ig 220..306 CDD:278476 21/100 (21%)
IG_like 220..306 CDD:214653 21/100 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.