DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and CG33543

DIOPT Version :9

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:422 Identity:88/422 - (20%)
Similarity:159/422 - (37%) Gaps:84/422 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 VGDTLVLPCQVENLGNFVLLWR--RG-TNVLTASNIMVTRDERVRLIDGYNLEISDLEPQDAGDY 175
            |.::.::.||... .:....||  || |...|...:.:.:.....|.    |....:..:|.|::
  Fly    61 VNESFIIFCQTVQ-KDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA----LVFEHIALEDRGNW 120

  Fly   176 VCQISD--------KINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYW 232
            .|:::.        .:.|:.:.:.|:||...:....|......|:|....:.|...|.|.|.:.|
  Fly   121 TCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW 185

  Fly   233 TKKSGANKSTA------RIGDGPILTLEKLERQQAGVYQCTA--------DNGVGDPVTVDMRLD 283
            . .:|...:|.      |:.:|  |.:..:.:..||.|.|.|        |:   |.:|:.:|  
  Fly   186 L-YNGEYINTVNSTKHNRLSNG--LYIRNVSQADAGEYTCRAMRITPTFSDS---DQITILLR-- 242

  Fly   284 VLYPPDIQVEKSWI--------HSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRI-MATR 339
                  ||.:..|.        ::..|....|.|....:|..:.:|..|:..|...:.|| :|..
  Fly   243 ------IQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADY 301

  Fly   340 ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEFYSPKWGRSPDSYNLTWKIDS 404
            .....|.:::..|  ||:|.|...|.||...:.::|  |||.... .|:..:....|...:::|.
  Fly   302 GATLQLQMKNASQ--FGDYKCKVANPLGMLERVIKL--RPGPKPL-GPRRFQLKKLYTNGFELDI 361

  Fly   405 YPP-----LEEVRLL-YRRVQMNETYQQ--PGRW-----HDFIL-TPEHRPASEPLTHIMSYTIK 455
            ..|     .:|:::. ||...|::|..:  .|.|     .||.. ..:|            :.|.
  Fly   362 QTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHGGKH------------FIIP 414

  Fly   456 NLHPGGYYEAIVQAKNRYGWNEVSDIFQFVVA 487
            :|.....|.....::|..|.::.|.:..|..|
  Fly   415 HLETNTTYLMRAASRNLAGLSDWSPVKVFTTA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 2/9 (22%)
IG_like 109..195 CDD:214653 16/91 (18%)
Ig 118..191 CDD:143165 14/83 (17%)
IG_like 205..274 CDD:214653 18/82 (22%)
IGc2 213..273 CDD:197706 17/73 (23%)
IGc2 301..367 CDD:197706 17/66 (26%)
FN3 392..486 CDD:238020 20/107 (19%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 15/61 (25%)
IG_like 256..336 CDD:214653 20/83 (24%)
IGc2 263..327 CDD:197706 17/65 (26%)
FN3 341..445 CDD:238020 21/116 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.