Sequence 1: | NP_524454.2 | Gene: | klg / 42707 | FlyBaseID: | FBgn0017590 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
Alignment Length: | 306 | Identity: | 91/306 - (29%) |
---|---|---|---|
Similarity: | 142/306 - (46%) | Gaps: | 22/306 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 SNVQQSAVAASTLTATLPRFLSRGHTYRAV------VGDTLVLPCQVENLGNFVLLWRRGTNVLT 142
Fly 143 ASNIMVTRDERVRLID----GYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPPSVRA 201
Fly 202 IPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQC 266
Fly 267 TADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQST 331
Fly 332 DRRIMATR-ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klg | NP_524454.2 | DUF1370 | 63..>124 | CDD:284518 | 17/45 (38%) |
IG_like | 109..195 | CDD:214653 | 25/97 (26%) | ||
Ig | 118..191 | CDD:143165 | 20/78 (26%) | ||
IG_like | 205..274 | CDD:214653 | 23/68 (34%) | ||
IGc2 | 213..273 | CDD:197706 | 21/59 (36%) | ||
IGc2 | 301..367 | CDD:197706 | 19/66 (29%) | ||
FN3 | 392..486 | CDD:238020 | |||
Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 7/16 (44%) |
Ig strand A' | 40..46 | CDD:409353 | 0/5 (0%) | ||
IG_like | 41..129 | CDD:214653 | 23/89 (26%) | ||
Ig strand B | 48..56 | CDD:409353 | 5/7 (71%) | ||
CDR1 | 56..60 | CDD:409353 | 1/4 (25%) | ||
FR2 | 61..68 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 61..67 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 10/34 (29%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 120..129 | CDD:409353 | 3/9 (33%) | ||
FR4 | 122..129 | CDD:409353 | 3/7 (43%) | ||
Ig strand A' | 139..144 | CDD:409353 | 1/4 (25%) | ||
IGc2 | 146..204 | CDD:197706 | 21/60 (35%) | ||
Ig strand B | 150..157 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 163..168 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 170..172 | CDD:409353 | 1/1 (100%) | ||
Ig strand E | 180..186 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 193..200 | CDD:409353 | 3/6 (50%) | ||
Ig_3 | 219..295 | CDD:404760 | 23/76 (30%) | ||
putative Ig strand A | 219..225 | CDD:409353 | 3/5 (60%) | ||
Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833614 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.740 |