DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and Negr1

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:306 Identity:91/306 - (29%)
Similarity:142/306 - (46%) Gaps:22/306 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SNVQQSAVAASTLTATLPRFLSRGHTYRAV------VGDTLVLPCQVENLGNFVLLWRRGTNVLT 142
            ||...:||..| |.:.||...|....:.||      .|||.||.|.:|: |.....|...::::.
Mouse    11 SNQWLAAVLLS-LCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLED-GASKGAWLNRSSIIF 73

  Fly   143 ASNIMVTRDERVRLID----GYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPPSVRA 201
            |.....:.|.||.:..    .|:|:|.:::..|.|.|.|.:..:  ....||| :.:.|||.:..
Mouse    74 AGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPPKIYD 137

  Fly   202 IPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQC 266
            |  |..:...:|..:||.|..:|.|.|.|.|...|.:.|.   ..:|..|.:..:.|.|||.|:|
Mouse   138 I--SNDMTINEGTNVTLTCLATGKPEPVISWRHISPSAKP---FENGQYLDIYGITRDQAGEYEC 197

  Fly   267 TADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQST 331
            :|:|.|..|....:|:.|.:.|.||..||...: .|....:.|.....|.....||:....:.:.
Mouse   198 SAENDVSFPDVKKVRVIVNFAPTIQEIKSGTVT-PGRSGLIRCEGAGVPPPAFEWYKGEKRLFNG 261

  Fly   332 DRRIMATR-ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELS 376
            .:.|:... :.|.:||:.::.||.||||:|||.|.||.:...:.|:
Mouse   262 QQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 25/97 (26%)
Ig strand B 118..122 CDD:409353 2/3 (67%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 2/3 (67%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 2/2 (100%)
Ig_3 196..270 CDD:464046 24/73 (33%)
Ig_3 287..364 CDD:464046 23/77 (30%)
FN3 392..486 CDD:238020
Negr1XP_036019026.1 IG_like 41..129 CDD:214653 23/89 (26%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 62..66 CDD:409353 0/3 (0%)
Ig strand E 95..99 CDD:409353 2/3 (67%)
Ig strand F 109..114 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig_3 132..201 CDD:464046 24/73 (33%)
IG_like 225..306 CDD:214653 23/81 (28%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.