DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klg and DIP-kappa

DIOPT Version :10

Sequence 1:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:388 Identity:103/388 - (26%)
Similarity:170/388 - (43%) Gaps:65/388 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RKSSQRRNRAPLQMN-----CPILIVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSA 90
            |..::||.|...:.|     ..|:...::..|:.|      ....|.|.::|.::|  .:.||:|
  Fly    11 RPHTRRRFRLQAEFNVRQLAITIIATAAVTMLMTA------TPTLAEIPSKGKHTR--LDTQQTA 67

  Fly    91 VAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLWRR--GTNVLTASNIMVTRDER 153
            ...|    ..|||..........||...::.|.||||..:.:.|.|  ...:|:..:.:::::.|
  Fly    68 QEDS----DFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSR 128

  Fly   154 VRLIDGYN------LEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARK 212
            :.|.  ||      |.|.::|..|.|.|:||::....|.:...::::|||.:....||..:..|:
  Fly   129 ISLT--YNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVRE 191

  Fly   213 GGPITLECKGSGNPVPSIYWTKKSGANK----STARIGDGPILTLEKLERQQAGVYQCTADNGVG 273
            |..|:|.||..|.|.|.:.|.::.|...    ....:.||.:|.:.|:.|.....|.|.|.|||.
  Fly   192 GQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVP 256

  Fly   274 DPVTVDMRLDVLYPPDI----QVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRR 334
            ..::..:.|.|.:||.:    |:|.:::    |.:..|.|...|.|.:...|        :|:|.
  Fly   257 PSISKRVHLRVQFPPMLSIPNQLEGAYL----GQDVILECHTEAYPASINYW--------TTERG 309

  Fly   335 IM----ATRA-------------NRHM-LTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRP 379
            .|    .:||             .::| |.||.:...|||.|.|||.||||.:...::|...|
  Fly   310 DMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 IG_like 109..195 CDD:214653 23/93 (25%)
Ig strand B 118..122 CDD:409353 0/3 (0%)
Ig strand C 131..135 CDD:409353 0/3 (0%)
Ig strand E 160..164 CDD:409353 3/9 (33%)
Ig strand F 174..179 CDD:409353 2/4 (50%)
Ig strand G 188..191 CDD:409353 0/2 (0%)
Ig_3 196..270 CDD:464046 23/77 (30%)
Ig_3 287..364 CDD:464046 26/98 (27%)
FN3 392..486 CDD:238020
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 23/93 (25%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 26/90 (29%)
Ig strand B 195..199 CDD:409301 2/3 (67%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 26/97 (27%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 1/11 (9%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.